SecReT4
Protein ID: 240851304
T4SS name [ID]Trw [146]
Gene symboltrwJ2
Locus tagBgr_19220
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2216927..2217670 [+]
ProductTrwJ2 protein
Component typeTrwJ
UniProt IDB0RKD4, C6AAS6
KEGG IDbgr:Bgr_19220
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.6e-30, Aligned region: 41..227
Protein Sequence: 247 a.a.     [Download]
>gi|240851304|ref|YP_002972707.1| TrwJ2 protein [Bartonella grahamii as4aup]
MRKILTITGMITLFGMINLTLTSNFSWGSTTQDSTVQIPFSKANYLEIIKLLKQQIEETKKQIENAKKIH
QSIIGPKIPPYTLGDTFSFFIPVSPFDYPDTKTNYQAIYVGHYRNLFRKLVLEEKRDSFQKLPYYKIREI
INTRLKYSGIIEKAVSLQTFKDIENRFKQVKDFLDKINNTKDLKELFDLQTRIKTMSSMIQNEYTKLQMV
RNLSDDEETLIEIQKRKLYSKIVASYNKRMPEIRYNQ
 
Nucleotide Sequence: 744 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2216927-2217670 Bartonella grahamii as4aup, complete genome
ATGAGAAAGATTCTTACTATAACAGGAATGATTACCCTTTTTGGAATGATAAATTTAACTCTAACGTCTA
ACTTTAGTTGGGGTTCTACAACTCAAGATTCAACTGTTCAAATTCCTTTTTCAAAAGCAAACTATCTGGA
AATTATTAAGTTGTTAAAACAACAAATTGAAGAAACCAAAAAGCAGATCGAAAACGCGAAAAAAATCCAT
CAGTCTATAATAGGACCTAAAATACCACCATATACACTAGGAGACACTTTTAGTTTTTTCATACCAGTTT
CGCCTTTTGACTACCCAGACACAAAAACAAACTACCAAGCCATATATGTTGGGCACTATAGAAATCTTTT
TCGTAAACTTGTTCTCGAAGAGAAAAGGGACAGCTTCCAGAAATTGCCGTATTATAAGATACGCGAAATA
ATTAATACACGTCTTAAATATAGTGGAATTATCGAAAAAGCTGTAAGTTTACAAACTTTCAAAGACATAG
AGAACCGCTTTAAACAAGTGAAAGATTTCTTAGATAAGATAAATAACACAAAAGATCTGAAAGAACTTTT
TGATCTACAAACACGCATTAAGACCATGTCATCCATGATCCAAAATGAATATACAAAGCTACAAATGGTC
AGAAATTTAAGCGATGACGAAGAGACTCTTATCGAAATACAAAAACGTAAATTGTATAGCAAAATTGTAG
CCTCTTACAACAAACGTATGCCTGAAATAAGATATAACCAATAA
 Primer design