SecReT4
Protein ID: 240851307
T4SS name [ID]Trw [146]
Gene symboltrwJ3
Locus tagBgr_19250
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2219113..2219838 [+]
ProductTrwJ3 protein
Component typeTrwJ
UniProt IDC6AAS9, B0RKD7
KEGG IDbgr:Bgr_19250
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.3e-26, Aligned region: 58..224
Protein Sequence: 241 a.a.     [Download]
>gi|240851307|ref|YP_002972710.1| TrwJ3 protein [Bartonella grahamii as4aup]
MKKQFIIVGMVTLLAMMNLAPANANDARISVSFASSSPAASPAEYLELINLLKKGEIIELLKKQLELKKE
QLSQTEKNYQAITKSQKTEPQKIDFSSFFLKEPESLYKSDKLSRESYQKVLKDEDKISESFNRMGKLLFE
RLEFFSLLNKAITLKSFEKVENRFKYIKSLFDNLQTKENLKDIADLQAHIDGSLAMIQNESITIQMITHL
RKAEQSLIKKKRREIDMKIFNHEAKGMPIIR
 
Nucleotide Sequence: 726 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2219113-2219838 Bartonella grahamii as4aup, complete genome
ATGAAAAAGCAATTTATTATAGTAGGAATGGTTACCCTTTTGGCAATGATGAATCTAGCTCCAGCAAATG
CAAATGACGCACGTATAAGCGTATCTTTCGCCTCCTCATCACCAGCTGCTTCACCAGCAGAATATCTGGA
GCTTATTAATCTATTAAAAAAAGGGGAAATTATTGAGCTCTTAAAAAAACAGCTTGAGTTGAAAAAAGAA
CAACTTTCGCAAACAGAAAAAAACTATCAAGCTATAACAAAGAGTCAGAAAACAGAACCTCAAAAAATAG
ACTTTTCTAGTTTTTTTCTCAAAGAACCAGAATCGCTCTATAAGAGTGATAAGCTTTCAAGGGAATCATA
TCAAAAGGTATTGAAGGACGAAGACAAAATTTCTGAGTCTTTTAATCGAATGGGCAAGTTGCTTTTTGAG
CGTTTAGAATTTTTTTCGCTACTAAATAAAGCTATAACTTTGAAAAGTTTTGAAAAAGTAGAAAATCGTT
TTAAATACATCAAAAGTCTATTTGATAATCTTCAAACAAAAGAAAACCTGAAAGATATTGCAGATCTTCA
AGCACATATCGATGGTTCATTAGCCATGATCCAAAATGAATCTATAACGATACAAATGATAACGCATTTA
CGTAAGGCTGAGCAATCACTTATCAAAAAGAAAAGACGCGAAATTGATATGAAAATTTTTAACCATGAAG
CAAAAGGGATGCCTATCATACGATGA
 Primer design