SecReT4
Protein ID: 240851309
T4SS name [ID]Trw [146]
Gene symboltrwH3
Locus tagBgr_19270
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2221110..2221262 [+]
ProductTrwH3 protein
Component typeTrwH
UniProt IDB0RKD9, C6AAT1
KEGG IDbgr:Bgr_19270
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 50 a.a.     [Download]
>gi|240851309|ref|YP_002972712.1| TrwH3 protein [Bartonella grahamii as4aup]
MKNIILVILIANLLSACALAPKLKQPNDRNRVPINKTIPAEIKRGDNGIS
 
Nucleotide Sequence: 153 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2221110-2221262 Bartonella grahamii as4aup, complete genome
ATGAAAAATATCATTCTTGTAATTTTGATTGCAAACCTTTTATCGGCTTGTGCATTAGCACCAAAGCTAA
AACAGCCCAATGATAGGAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATTAAGCGAGGAGACAA
CGGAATCTCATAA
 Primer design