SecReT4
Protein ID: 240851310
T4SS name [ID]Trw [146]
Gene symboltrwJ4
Locus tagBgr_19280
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2221351..2222295 [+]
ProductTrwJ4 protein
Component typeTrwJ
UniProt IDC6AAT2, B0RKE0
KEGG IDbgr:Bgr_19280
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.6e-29, Aligned region: 131..297
Protein Sequence: 314 a.a.     [Download]
>gi|240851310|ref|YP_002972713.1| TrwJ4 protein [Bartonella grahamii as4aup]
MQKLIIIIAISAFLGTTNLVRSDTITKQGGAHSRIPIIPGMGSGGLSTSKDYKPEPPKGYKPPSALPPDV
KIDLSTLGTMRNRIPSKPSGSKPSNTTPVSPTTQVPKSTFVSAPPAEYLEIINLLKKGEIIELLKKQLEL
KKEQLSQVEKAYQAITKSQKTEPQKIDFSSFFLKEPEALYKSDKLSRESYQKVLEEENKIYGSFDQMGKA
ISGRLKFASILDKAVSLETFENVENRFKYLQHLLDEIQTKENLKDTADLQAHIDGSLTMIQNEFIKMEMV
AHLRNAEQSLIKRKRRELDMKIFDHEAKRMPTIR
 
Nucleotide Sequence: 945 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2221351-2222295 Bartonella grahamii as4aup, complete genome
ATGCAAAAGCTGATTATTATCATAGCAATTAGTGCGTTTCTTGGAACAACAAACTTAGTAAGAAGTGACA
CTATTACTAAGCAAGGAGGAGCTCATAGCCGTATTCCTATAATTCCTGGTATGGGGTCAGGAGGTCTCAG
TACAAGCAAAGATTATAAACCAGAACCACCAAAAGGCTATAAGCCACCATCTGCACTTCCACCCGATGTT
AAAATCGATCTTTCTACTTTGGGAACGATGAGAAATCGCATACCGTCCAAACCTAGTGGCTCTAAGCCAT
CTAACACAACTCCAGTATCTCCCACAACTCAGGTACCTAAATCAACTTTTGTATCTGCTCCACCTGCAGA
ATATCTAGAGATTATTAATCTATTAAAAAAAGGGGAAATTATTGAGCTGTTAAAAAAACAGCTTGAGTTG
AAAAAAGAACAACTTTCGCAAGTAGAAAAAGCTTATCAGGCTATAACAAAGAGTCAGAAAACAGAACCTC
AAAAAATAGACTTTTCTAGTTTTTTTCTCAAAGAACCAGAAGCGCTCTATAAGAGTGATAAGCTTTCAAG
GGAATCATATCAAAAGGTATTAGAGGAAGAAAACAAAATTTATGGGTCTTTTGATCAAATGGGCAAAGCT
ATTTCGGGGCGCTTAAAATTTGCATCGATACTAGATAAAGCTGTAAGTTTAGAAACTTTTGAAAACGTAG
AAAATCGTTTTAAATACCTCCAACATCTATTAGATGAAATTCAAACAAAAGAAAACCTGAAAGATACTGC
AGATCTTCAAGCACATATCGATGGTTCGTTAACCATGATCCAAAATGAATTTATAAAGATGGAAATGGTA
GCGCATTTACGTAATGCTGAGCAATCACTTATCAAAAGGAAAAGACGCGAACTTGATATGAAAATTTTTG
ACCATGAAGCAAAAAGGATGCCTACCATACGATAA
 Primer design