SecReT4
Protein ID: 240851312
T4SS name [ID]Trw [146]
Gene symboltrwH4
Locus tagBgr_19300
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2223567..2223710 [+]
ProductTrwH4 protein
Component typeTrwH
UniProt IDB0RKD6, C6AAS8
KEGG IDbgr:Bgr_19240, bgr:Bgr_19300
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|240851312|ref|YP_002972715.1| TrwH4 protein [Bartonella grahamii as4aup]
MKNIILVILIANLLSACALAPKLKQPNDRNRVPINKTIPAEIKRGDR
 
Nucleotide Sequence: 144 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2223567-2223710 Bartonella grahamii as4aup, complete genome
ATGAAAAATATCATTCTTGTAATTTTGATTGCAAACCTTTTATCGGCTTGTGCATTAGCACCAAAGCTAA
AACAGCCCAATGATAGGAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATTAAGCGAGGAGACAG
ATGA
 Primer design