SecReT4
Protein ID: 240851313
T4SS name [ID]Trw [146]
Gene symboltrwG
Locus tagBgr_19310
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2223707..2224408 [+]
ProductTrwG protein
Component typeTrwG
UniProt IDC6AAT5, B0RKE3
KEGG IDbgr:Bgr_19310
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.7e-52, Aligned region: 22..228
Protein Sequence: 233 a.a.     [Download]
>gi|240851313|ref|YP_002972716.1| TrwG protein [Bartonella grahamii as4aup]
MKTKQVKPVKAEQLSSYYEESRGLERDLINEFIRSRRTAWRVASTVGLFGLFGMICGVVGFSQPAPTPLV
LRVDNTTGAVDVISVMREHETSYGEVVDRYWLNQYVLNRENYDYDTIQLNYDTTALLSAASVQQEYYKIY
DGENARDKVLSNKARITVKVRSIQLNGLGQATVRFTTQQLDSSGATTGPKQHQIATIGYTYVGAPMKSSD
RLLNPLGFQITSYRSDPEILLND
 
Nucleotide Sequence: 702 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2223707-2224408 Bartonella grahamii as4aup, complete genome
ATGAAAACAAAACAAGTAAAACCAGTGAAAGCCGAACAACTTAGCAGTTATTATGAAGAAAGCCGTGGCT
TAGAACGTGATCTTATTAATGAATTTATAAGATCGCGCAGAACGGCATGGCGTGTAGCGAGTACTGTTGG
TCTTTTTGGCTTATTCGGTATGATATGTGGAGTCGTTGGGTTTTCTCAACCAGCTCCAACTCCCTTAGTA
TTGCGCGTTGATAATACGACGGGTGCAGTTGATGTTATCTCAGTCATGCGTGAACACGAGACCAGCTATG
GTGAAGTTGTAGATAGATATTGGCTAAACCAATATGTGCTTAACCGCGAAAATTACGACTACGATACGAT
TCAACTGAACTATGACACAACAGCACTTTTAAGTGCGGCATCTGTTCAACAAGAATATTATAAAATCTAT
GATGGAGAAAATGCACGGGACAAAGTGCTTTCCAATAAAGCACGTATCACAGTCAAAGTACGATCAATCC
AGCTTAATGGACTCGGTCAAGCAACTGTACGTTTTACGACTCAGCAACTTGACAGCAGCGGTGCTACTAC
CGGACCAAAACAGCACCAGATTGCAACAATTGGTTACACCTATGTCGGTGCACCCATGAAATCATCTGAT
CGATTGCTTAACCCCCTTGGTTTTCAAATAACAAGTTACCGTTCTGACCCAGAAATACTGTTAAATGATT
AA
 Primer design