SecReT4
Protein ID: 240851314
T4SS name [ID]Trw [146]
Gene symboltrwF
Locus tagBgr_19320
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2224401..2225228 [+]
ProductTrwF protein
Component typeTrwF
UniProt IDC6AAT6, B0RKE4
KEGG IDbgr:Bgr_19320
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3e-61, Aligned region: 40..249
Protein Sequence: 275 a.a.     [Download]
>gi|240851314|ref|YP_002972717.1| TrwF protein [Bartonella grahamii as4aup]
MIKELIVMKKLAFVVLLSSFSSLYTVPVQALKSPSNSQYDHRIRYITYNEADVVQIETVLGVATHIILEE
GEQYITHAFGDSEAYAFAHKGRHIFIKPKAELANTNLIVVTDKRSYKFRLQFRNDRAGSTYELAFHYPDS
NDEKSEENNRRLAIEHGFHQSVKGYNLSYTMSGHQDIAPINAWDNGRITYFKFPANMDMPSIYVVDAEGN
ESLIPRTVIGSSNDIIAVHKVNPKWLIRLGKRALAVFNEAYDPNGVPNTTGTVSSVVYRINKGGK
 
Nucleotide Sequence: 828 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2224401-2225228 Bartonella grahamii as4aup, complete genome
ATGATTAAGGAATTGATTGTTATGAAAAAACTTGCGTTCGTTGTTCTATTGTCTTCGTTTTCTTCTCTTT
ATACGGTACCTGTGCAGGCGCTCAAAAGTCCATCAAATTCACAATATGATCACCGCATTCGCTATATAAC
ATATAACGAAGCCGATGTGGTTCAAATTGAAACAGTTCTTGGTGTAGCAACACATATTATTCTTGAAGAA
GGTGAACAGTATATCACTCATGCCTTTGGCGATTCAGAAGCCTATGCCTTTGCTCATAAAGGGCGGCATA
TTTTTATTAAACCAAAAGCAGAACTTGCCAATACCAATCTCATCGTTGTAACTGACAAACGGAGTTACAA
ATTCCGACTACAATTTCGAAATGACCGTGCAGGATCAACATATGAATTAGCTTTCCATTATCCCGATTCA
AATGATGAAAAGTCAGAAGAAAACAACCGACGCCTTGCGATTGAACATGGTTTTCACCAAAGCGTCAAAG
GCTATAATCTGAGTTATACTATGAGCGGTCACCAAGATATTGCTCCGATAAATGCTTGGGACAATGGGCG
TATTACTTACTTCAAATTTCCCGCTAACATGGATATGCCATCGATTTATGTCGTAGATGCTGAAGGCAAT
GAAAGCTTAATACCACGCACCGTTATCGGCAGTTCTAATGATATTATCGCCGTTCATAAGGTCAATCCTA
AATGGCTCATACGGCTTGGTAAACGCGCTCTAGCTGTTTTTAATGAAGCCTATGACCCCAATGGCGTACC
AAACACAACAGGGACAGTATCTTCGGTGGTTTATCGTATCAATAAAGGAGGAAAATGA
 Primer design