SecReT4
Protein ID: 240851315
T4SS name [ID]Trw [146]
Gene symboltrwE
Locus tagBgr_19330
StrainBartonella grahamii as4aup
Repliconchromosome [GenBank: NC_012846] [Browse all T4SS(s) in this replicon]
Location [Strand]2225228..2226385 [+]
ProductTrwE protein
Component typeTrwE
UniProt IDB0RKE5, C6AAT7
KEGG IDbgr:Bgr_19330
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-61, Aligned region: 197..376
Protein Sequence: 385 a.a.     [Download]
>gi|240851315|ref|YP_002972718.1| TrwE protein [Bartonella grahamii as4aup]
MFDNKEGEGKGTKLDNVEQKHIEGTYGGSELGSERRPTIPGTRALLVVGLIVIVTIPIALTWKAFKMRNT
VEVEEENPQQIVQQIIPNYVPRIIEEPKTVEEAEKPAQIEDSNLDIPPALSKLLQTAIPPHMLQDSEELA
RKRMLSSSLNNGGSEGSTDTNNKASNKDRGSGVLFDNLQPVRLGQSHAVQLRNRDFLITQGTQIDCTLET
KIITSQPGMTTCHLTRDIYSTSGRVVLLDRGSKVVGFYQSGIQQGQTRVFVQWSRIETPSGVVVNLDSPG
TGPLGEAGIGGWVDRRFWERFGSAIMVSIIGDLGEWVKGKVSKISKENKENSQNKGAQNAESIAIDVLQN
SINITPTLYKNQGERVNIFVARDLDFSDVYSLVTR
 
Nucleotide Sequence: 1158 bp     [Download]
>gi|240849682|ref|NC_012846.1|:2225228-2226385 Bartonella grahamii as4aup, complete genome
ATGTTTGACAATAAGGAAGGAGAGGGAAAAGGTACAAAACTGGACAACGTCGAGCAAAAACATATTGAAG
GTACTTATGGAGGGTCGGAATTAGGTTCTGAACGTCGTCCGACAATTCCAGGTACCCGTGCATTGTTAGT
GGTAGGACTTATTGTCATAGTAACGATACCGATTGCCTTGACTTGGAAAGCTTTTAAAATGCGTAATACC
GTGGAAGTTGAGGAAGAAAACCCACAACAAATAGTACAGCAAATTATACCAAACTACGTCCCTCGGATTA
TAGAAGAGCCAAAGACTGTAGAAGAAGCAGAAAAACCAGCACAAATAGAAGATTCAAACCTAGATATTCC
ACCGGCCTTGAGTAAGCTTCTTCAAACAGCCATTCCTCCACACATGCTCCAAGATTCTGAAGAATTAGCA
CGCAAACGTATGCTCAGTTCTAGCCTTAACAACGGTGGTAGCGAAGGATCTACAGATACAAATAATAAAG
CATCGAATAAAGATAGAGGTAGTGGCGTATTATTTGATAACCTTCAGCCCGTGCGTTTAGGTCAATCACA
TGCGGTGCAACTTCGTAACCGTGACTTTTTGATTACGCAAGGAACGCAAATAGATTGCACGCTAGAAACA
AAGATCATTACATCACAACCCGGAATGACGACATGTCATTTAACACGCGATATTTATTCCACAAGTGGTC
GTGTTGTTTTGCTTGACCGTGGTTCTAAAGTCGTTGGTTTTTACCAAAGTGGCATACAACAAGGACAAAC
GCGTGTGTTTGTGCAATGGTCACGCATCGAAACGCCTTCTGGTGTTGTTGTCAATCTTGACTCACCTGGC
ACAGGTCCTTTGGGTGAAGCGGGTATTGGTGGCTGGGTTGACAGACGCTTTTGGGAGAGATTTGGTAGTG
CAATTATGGTAAGCATTATCGGTGATTTAGGAGAATGGGTAAAAGGAAAAGTTAGTAAAATCAGTAAAGA
AAATAAAGAGAACTCACAAAATAAAGGTGCTCAGAATGCTGAATCTATAGCGATCGATGTTCTTCAAAAC
TCCATCAATATCACACCAACACTTTACAAAAACCAAGGCGAACGAGTAAATATTTTTGTTGCTCGTGATC
TGGATTTCAGCGATGTCTACAGTCTTGTCACACGTTAA
 Primer design