SecReT4
Protein ID: 240851432
T4SS name [ID]VirB [461]
Gene symbolvblB7
Locus tagBgr_p00120
StrainBartonella grahamii as4aup
Repliconplasmid pBGR3 [GenBank: NC_012847] [Browse all T4SS(s) in this replicon]
Location [Strand]10429..10716 [+]
ProductVblB7 protein
Component typeVirB7
UniProt IDC6AF16
KEGG IDbgr:Bgr_p00120
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 95 a.a.     [Download]
>gi|240851432|ref|YP_002972819.1| VblB7 protein [Bartonella grahamii as4aup]
MRGFKKIGIILPFLFLSGCMSSPNTLKSLPKCDGYSKRPLNRSMWNWEGKKPTPRPIIISGNTQSSVKES
KLETLLAQKLTDEEMKSYKNCGQKA
 
Nucleotide Sequence: 288 bp     [Download]
>gi|240851420|ref|NC_012847.1|:10429-10716 Bartonella grahamii as4aup plasmid pBGR3, complete sequence
ATGCGGGGTTTTAAAAAAATTGGGATTATATTGCCATTTCTCTTTCTTAGTGGCTGTATGTCTTCACCAA
ACACGCTGAAATCACTCCCAAAGTGTGATGGATATTCTAAACGTCCACTCAACAGATCAATGTGGAATTG
GGAAGGGAAGAAGCCCACTCCAAGACCTATTATCATAAGTGGCAATACACAATCATCCGTGAAAGAGAGC
AAACTTGAAACGCTTTTGGCACAAAAATTAACGGACGAAGAAATGAAGTCTTACAAAAATTGCGGGCAAA
AAGCATGA
 Primer design