SecReT4
Protein ID: 240851433
T4SS name [ID]VirB [461]
Gene symbolvblB8
Locus tagBgr_p00130
StrainBartonella grahamii as4aup
Repliconplasmid pBGR3 [GenBank: NC_012847] [Browse all T4SS(s) in this replicon]
Location [Strand]10713..11384 [+]
ProductVblB8 protein
Component typeVirB8
UniProt IDC6AF17
KEGG IDbgr:Bgr_p00130
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.8e-62, Aligned region: 12..220
Protein Sequence: 223 a.a.     [Download]
>gi|240851433|ref|YP_002972820.1| VblB8 protein [Bartonella grahamii as4aup]
MKENAVEQYIAEARSFDQDRMLASRRTTRVSLAIAGIAVAVAIMSSLAVITLTPLKTVEPFVIRVDNSTG
ITEVVEALKEGPTNVDEAITRYFAAKYVRFREGFVVEETQNNFETISLLSSPEERERFAGWYGAKNPQSP
QILYKHATVTITIKSISFINENVAQVRYYRTVRNNDNNKEFITHWVATLTFEYTNAPISVQNRLINPLGF
IVNEYRTDPEVVN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|240851420|ref|NC_012847.1|:10713-11384 Bartonella grahamii as4aup plasmid pBGR3, complete sequence
ATGAAAGAAAATGCCGTAGAACAATATATTGCTGAAGCACGCTCGTTCGATCAAGATCGCATGCTCGCCT
CACGCCGCACCACCCGCGTCTCGCTTGCAATCGCCGGCATCGCCGTTGCGGTTGCAATAATGTCCTCTCT
GGCGGTCATCACCCTCACACCCCTTAAAACCGTGGAACCTTTTGTCATCCGCGTTGATAATTCAACCGGC
ATCACTGAAGTCGTAGAAGCCTTAAAAGAAGGTCCAACAAACGTCGACGAAGCCATCACCCGCTATTTTG
CAGCAAAATATGTCCGCTTCCGTGAAGGTTTCGTCGTAGAAGAAACACAAAATAACTTCGAAACCATCTC
TCTCCTCTCTTCTCCTGAAGAACGAGAAAGATTTGCAGGATGGTACGGAGCAAAAAATCCCCAAAGCCCT
CAAATTCTTTATAAACACGCCACCGTTACAATAACAATAAAATCAATTTCTTTTATCAATGAAAATGTCG
CCCAAGTGCGTTACTACAGAACTGTGCGTAACAACGACAACAACAAAGAATTCATCACCCACTGGGTTGC
AACACTCACCTTTGAATATACCAATGCCCCTATCTCTGTCCAAAACCGTTTGATAAACCCTCTAGGGTTT
ATCGTTAATGAATATAGAACCGATCCGGAAGTGGTCAACTGA
 Primer design