SecReT4
Protein ID: 240851436
T4SS name [ID]VirB [461]
Gene symbolvblB11
Locus tagBgr_p00160
StrainBartonella grahamii as4aup
Repliconplasmid pBGR3 [GenBank: NC_012847] [Browse all T4SS(s) in this replicon]
Location [Strand]13402..14454 [+]
ProductVblB11 protein
Component typeVirB11
UniProt IDC6AF20
KEGG IDbgr:Bgr_p00160
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.5e-84, Aligned region: 18..330
DEAD [PF00270], Evalue: 8.2e-05, Aligned region: 174..230
Protein Sequence: 350 a.a.     [Download]
>gi|240851436|ref|YP_002972823.1| VblB11 protein [Bartonella grahamii as4aup]
MPSAKNAERASIVLTKLKILDDFLNDENLFEIVVNRPGEVIVEGPNGWQTHILKELTYSELEGIAKVVAA
YTTQKISVENPVLSATLPNNERIQIVMPPAVAANTISMTIRKPSSRTFSLESLHENNLFSVAQNTSFTPT
QQMTERLSELSDTDKELTDLFIAKDFCTFLERAVITQQNILISGKTGSGKTTLSKALIAKIPEYERILTI
EDTPELVVPHSNKVQLFYSKDNQGLAKAGAKELLESGLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSI
TTVHASTALAAFEQMTLLVKESDGGGNLARDDIRGLLISMIDVIIQCKRLEGKFRVTEIYYDPFKRRDAF
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|240851420|ref|NC_012847.1|:13402-14454 Bartonella grahamii as4aup plasmid pBGR3, complete sequence
ATGCCATCAGCAAAAAATGCAGAACGAGCTTCCATCGTTTTAACAAAATTAAAGATCTTAGATGACTTCC
TTAATGATGAAAATTTATTTGAAATTGTTGTCAATCGCCCCGGCGAAGTGATTGTTGAGGGTCCCAATGG
TTGGCAAACCCACATCTTAAAAGAACTAACCTACAGCGAACTAGAAGGGATTGCAAAAGTTGTTGCTGCC
TACACAACACAAAAAATCAGTGTAGAAAACCCCGTTCTCTCCGCAACACTGCCAAACAACGAACGCATAC
AAATTGTTATGCCTCCAGCTGTTGCAGCCAATACCATTAGCATGACCATTCGTAAACCTTCATCACGCAC
TTTTTCTCTTGAAAGTTTACATGAAAACAATCTGTTTTCTGTCGCCCAAAACACCAGTTTCACACCCACG
CAACAAATGACAGAACGGTTATCCGAACTCTCTGATACAGACAAAGAGCTAACAGATCTCTTTATCGCTA
AAGATTTTTGCACCTTTTTAGAGAGAGCCGTTATTACACAACAAAATATCTTAATATCTGGAAAAACCGG
TTCTGGGAAAACAACCCTCTCTAAAGCTTTAATTGCAAAAATCCCTGAATATGAACGAATTCTCACCATT
GAAGACACGCCAGAACTTGTCGTTCCCCATTCAAACAAAGTCCAACTTTTTTATTCAAAAGATAACCAAG
GCTTAGCAAAAGCAGGCGCAAAAGAACTGCTTGAATCTGGCTTACGCATGCGCCCCGACAGAATCCTTCT
ACAAGAGCTGCGTGATGGTACAGCCTTTTACTACATCCGTAATGTCAACTCTGGTCACCCCGGCTCCATT
ACCACCGTCCACGCCTCAACAGCACTTGCAGCCTTCGAACAAATGACCCTTTTAGTCAAAGAAAGTGACG
GTGGTGGTAATTTAGCGCGCGATGATATCCGCGGCTTATTAATCTCGATGATAGATGTCATCATCCAATG
CAAACGCCTTGAAGGCAAATTTCGTGTAACAGAAATCTATTACGACCCCTTCAAACGCCGTGATGCTTTT
TAA
 Primer design