SecReT4
Protein ID: 240851443
T4SS name [ID]VirB [461]
Gene symboltraG
Locus tagBgr_p00230
StrainBartonella grahamii as4aup
Repliconplasmid pBGR3 [GenBank: NC_012847] [Browse all T4SS(s) in this replicon]
Location [Strand]20983..22896 [+]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDC6AF27
KEGG IDbgr:Bgr_p00230
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.1e-101, Aligned region: 159..635
TraG-D_C [PF12696], Evalue: 5.7e-30, Aligned region: 477..595
TrwB_AAD_bind [PF10412], Evalue: 6.1e-21, Aligned region: 215..612
Protein Sequence: 637 a.a.     [Download]
>gi|240851443|ref|YP_002972830.1| conjugal transfer protein TraG [Bartonella grahamii as4aup]
MINNLDRKQIIFLICPFLFSIIILFLVNITINNITENGTTQDAYWFVRSKPLDILVLIALSCSSFILLQK
RHIRKNITIASLISFCLFAAYYSINEYIRLSPYVGQNNMTWADVFPFFDRMVLSGSIIGIIILGFTMNLS
LPKTSPLKKLKNTIFGGAQWMNIKQLEKIFPSDGEIVIGERYRVDEDVVKDVQFNPNDKTTWGKGGSQPL
LTYKLDFDSTHMLFFAGSGGYKTTSNVIPTCLKYSGPLIVFDPSTEIAPIVEDAREKLNKNTVHVLAPHG
TSTKTFNPLDWLLDESIPAYEREAGLVEIARLLLSENYKSTSTDQFFVSHAHNLLTGLLAHIVFSDEYKL
EEKNLKTLRMIVSEPEPSVIGKLQSIQSSSSSQFIRETLGVFTNMAPQTFSGVYATASKDTQWLSLDNYA
NLISGDDFKTTDIAKENIDIFLNIPSKILKSYPGVGRILVGSLLKAMEAANGNYKKRVLFVLDEIDLLGY
MNILEEARDRGRKYGISLMLFYQSVGQLERHFGSSGTMAWLESCAFVSYAAIKDIKTAENISKACGKMTV
EVKNSRKPQGAFHTRGTENVNTQQRPLIYPHEITQEMRKDEQIILMQGQPPIRCGRAIYFRRKDLRALAN
KNRFAPK
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|240851420|ref|NC_012847.1|:20983-22896 Bartonella grahamii as4aup plasmid pBGR3, complete sequence
ATGATAAACAATCTAGATCGTAAACAAATCATATTTTTAATATGCCCTTTCCTCTTTTCAATCATAATTC
TTTTTCTTGTAAACATAACAATAAATAACATTACAGAAAATGGTACTACCCAAGATGCTTATTGGTTTGT
TCGTTCAAAACCTCTCGATATTCTCGTCCTTATTGCACTTTCATGTTCTTCATTTATTCTATTACAAAAA
AGACATATAAGAAAAAATATCACCATAGCATCATTAATCTCCTTTTGTCTTTTTGCTGCCTACTACAGTA
TAAATGAATATATCAGATTAAGTCCTTATGTAGGACAAAATAACATGACATGGGCTGATGTTTTTCCTTT
CTTTGATAGGATGGTTTTGAGCGGTTCAATCATTGGTATTATTATCCTTGGTTTTACGATGAATCTATCG
TTGCCAAAAACATCACCTTTGAAAAAATTAAAAAATACGATCTTCGGCGGCGCTCAATGGATGAATATAA
AACAACTTGAAAAGATCTTTCCAAGTGATGGTGAAATAGTTATAGGAGAGCGCTATAGAGTCGACGAAGA
TGTTGTTAAAGATGTCCAATTTAATCCTAACGACAAAACAACATGGGGGAAAGGTGGTAGCCAGCCACTG
TTAACATACAAACTTGATTTTGATTCAACTCATATGTTATTTTTTGCTGGTTCTGGTGGTTATAAAACAA
CCAGCAATGTTATTCCAACTTGTCTCAAATATTCCGGTCCACTGATCGTTTTTGATCCTTCAACTGAAAT
CGCTCCAATCGTTGAAGACGCACGAGAAAAATTAAACAAAAATACCGTACATGTTCTCGCTCCTCATGGA
ACTTCAACAAAAACTTTTAATCCTTTAGACTGGTTATTAGATGAAAGCATTCCAGCCTATGAAAGGGAAG
CGGGTCTCGTAGAGATAGCACGACTCCTCCTTTCAGAAAATTATAAATCCACTTCAACCGATCAATTTTT
TGTATCACACGCACATAATTTATTAACAGGACTACTTGCACATATTGTCTTTTCTGATGAGTACAAGTTA
GAGGAAAAAAACTTAAAAACTCTTCGTATGATTGTATCAGAGCCAGAACCATCCGTGATTGGAAAATTGC
AATCTATACAATCAAGTTCTTCATCGCAATTCATTCGTGAAACCCTTGGGGTCTTTACCAATATGGCACC
GCAAACTTTCTCTGGTGTTTATGCTACTGCTTCTAAAGATACCCAATGGCTCTCCCTTGATAATTATGCC
AACCTTATAAGTGGTGATGACTTTAAAACAACTGATATTGCAAAAGAAAATATCGATATCTTTTTGAATA
TTCCGTCCAAAATTCTAAAATCTTACCCTGGTGTGGGACGCATTCTTGTTGGTTCTCTTCTCAAAGCTAT
GGAAGCCGCAAATGGAAACTATAAAAAAAGAGTCCTCTTTGTTTTAGATGAGATTGATCTTTTAGGATAT
ATGAACATCTTAGAAGAAGCACGTGACCGTGGGCGTAAATATGGAATATCTCTCATGCTCTTTTACCAAT
CTGTAGGACAACTTGAACGTCACTTCGGTTCATCAGGTACTATGGCATGGTTGGAAAGCTGTGCTTTTGT
AAGTTATGCCGCTATTAAAGATATTAAAACGGCTGAAAATATATCAAAGGCATGCGGTAAAATGACTGTT
GAAGTGAAAAATTCAAGAAAACCTCAAGGAGCATTCCATACAAGAGGGACAGAAAATGTAAACACCCAGC
AAAGACCTTTAATTTATCCTCATGAAATTACCCAAGAAATGCGAAAAGACGAACAGATCATTCTCATGCA
AGGGCAGCCCCCTATTCGTTGCGGACGTGCCATATATTTTAGAAGAAAAGATTTAAGGGCTCTTGCTAAC
AAAAATAGATTTGCCCCTAAATAA
 Primer design