SecReT4
Protein ID: 241518223
T4SS name [ID]Trb [238]
Gene symbol-
Locus tagRleg_5483
StrainRhizobium leguminosarum bv. trifolii WSM1325
Repliconplasmid pR132503 [GenBank: NC_012853] [Browse all T4SS(s) in this replicon]
Location [Strand]69390..69770 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDC6B8R2
KEGG IDrlg:Rleg_5483
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.4e-21, Aligned region: 9..98
Protein Sequence: 126 a.a.     [Download]
>gi|241518223|ref|YP_002978851.1| Conjugal transfer protein TrbC [Rhizobium leguminosarum bv. trifolii WSM1325]
MRLERSIDLAAIALVLAFILADPAWASSGGGLPWEDPLQQIQESITGPVAGFIALAAVAIAGGMLIFGGE
LNDFARRLMYVVLVAGILLGATQIVALFGATGASIGIADHKLKARDGEEGRAGNGG
 
Nucleotide Sequence: 381 bp     [Download]
>gi|241518161|ref|NC_012853.1|:69390-69770 Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence
ATGCGGCTTGAACGCTCGATAGACCTCGCCGCCATCGCGCTTGTATTGGCCTTCATCCTTGCCGACCCGG
CTTGGGCAAGTTCGGGCGGCGGCCTGCCCTGGGAAGATCCTCTTCAACAAATCCAAGAATCGATCACCGG
TCCGGTTGCCGGGTTTATCGCGCTTGCTGCTGTCGCAATCGCAGGCGGCATGTTGATCTTCGGCGGAGAA
CTCAACGACTTCGCACGCCGGCTCATGTACGTGGTGCTCGTTGCCGGCATTCTGCTTGGCGCGACCCAGA
TCGTCGCCCTTTTTGGCGCGACCGGCGCCTCTATCGGCATTGCCGATCACAAGCTGAAGGCCCGCGATGG
CGAAGAGGGGAGGGCAGGTAATGGCGGTTGA
 Primer design