SecReT4
Protein ID: 241518228
T4SS name [ID]Trb [238]
Gene symbol-
Locus tagRleg_5488
StrainRhizobium leguminosarum bv. trifolii WSM1325
Repliconplasmid pR132503 [GenBank: NC_012853] [Browse all T4SS(s) in this replicon]
Location [Strand]73508..74656 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDC6B8R7
KEGG IDrlg:Rleg_5488
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.2e-30, Aligned region: 53..265
Protein Sequence: 382 a.a.     [Download]
>gi|241518228|ref|YP_002978856.1| conjugal transfer protein TrbL [Rhizobium leguminosarum bv. trifolii WSM1325]
MLAIGLAIVAVGPAFAQQGSALSTLENQVVSAAKDWESTVSRAARSLFWILAGIEIGIAAVWLALQAASL
DSWFAELVRRIMFVGLFAFILDRGPALAKAVVDSLYQLGAEGGSASPAAIFDAGIEVADKMSEQVQFGLF
EDNSLAIAAVFAMVVVVIAFSLVAAVFVAVIVEMYVGLLAGMIMLGLGGSSFTKDFAVKYLVYAFSVGMK
LMALVMIARIGSEVLIGLAEVSVAAEQQLITSLAIAGLSVVVFMISIYVPNILQGVVQGVSVSGGMEVIR
HGGQAGSFALGAGILAGGGASAGFAAARAARAEGASIAGAALRGVGAGLSATGEAVGSAAKEKAIGSPGA
HASSLLGLANAKLDQAQARGGLRPSPLRDDKK
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|241518161|ref|NC_012853.1|:73508-74656 Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence
ATGCTTGCGATCGGCCTTGCGATCGTGGCGGTAGGGCCAGCCTTCGCCCAGCAAGGATCGGCGCTCTCGA
CGTTGGAAAACCAGGTGGTCAGTGCCGCGAAGGATTGGGAGTCGACGGTGTCACGGGCAGCTCGGTCGCT
CTTTTGGATCCTGGCTGGGATAGAAATTGGAATAGCAGCCGTATGGCTGGCGCTGCAAGCTGCGTCACTG
GATAGTTGGTTCGCGGAACTCGTTCGCCGGATCATGTTCGTCGGTCTCTTTGCCTTTATCCTGGATCGGG
GACCAGCCCTCGCCAAGGCGGTGGTGGACAGCCTATATCAGTTGGGCGCGGAAGGTGGCTCCGCTTCTCC
GGCCGCGATCTTCGACGCTGGCATAGAGGTCGCGGACAAAATGTCCGAACAGGTCCAGTTCGGCCTCTTT
GAGGACAACTCTCTGGCTATTGCCGCCGTCTTCGCCATGGTTGTTGTCGTCATCGCGTTCTCGCTCGTCG
CCGCGGTGTTCGTCGCTGTCATCGTCGAAATGTATGTAGGCTTGTTGGCCGGCATGATCATGCTTGGATT
AGGTGGTTCATCCTTCACCAAGGACTTCGCGGTCAAATATCTCGTCTATGCGTTTTCAGTCGGTATGAAG
CTGATGGCACTGGTAATGATTGCGCGCATCGGCTCGGAGGTTCTCATCGGCTTGGCCGAGGTGTCGGTCG
CGGCTGAACAGCAACTCATCACCAGCCTGGCGATCGCTGGCCTATCAGTTGTCGTCTTCATGATATCAAT
CTACGTCCCAAACATTCTGCAGGGTGTCGTCCAAGGCGTCTCCGTCAGCGGCGGCATGGAGGTGATCCGC
CATGGCGGGCAGGCGGGATCATTCGCACTGGGCGCAGGGATTCTAGCTGGCGGTGGCGCCAGCGCGGGCT
TTGCCGCCGCGCGTGCTGCGCGTGCCGAGGGTGCGTCCATAGCGGGCGCTGCCTTGCGCGGCGTGGGTGC
GGGATTGAGCGCGACGGGCGAAGCGGTCGGATCCGCGGCCAAGGAAAAGGCGATCGGCTCACCCGGCGCC
CATGCCAGCTCTCTTCTTGGCCTCGCCAATGCGAAACTCGATCAGGCGCAGGCACGCGGCGGTTTACGCC
CGTCGCCGCTCCGCGACGACAAAAAATAA
 Primer design