SecReT4
Protein ID: 241518230
T4SS name [ID]Trb [238]
Gene symbol-
Locus tagRleg_5490
StrainRhizobium leguminosarum bv. trifolii WSM1325
Repliconplasmid pR132503 [GenBank: NC_012853] [Browse all T4SS(s) in this replicon]
Location [Strand]75355..76176 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDC6B8R9
KEGG IDrlg:Rleg_5490
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.4e-58, Aligned region: 58..271
Protein Sequence: 273 a.a.     [Download]
>gi|241518230|ref|YP_002978858.1| conjugal transfer protein TrbG [Rhizobium leguminosarum bv. trifolii WSM1325]
MRRATYLAALGCAWVVVFATNEAKAQSMTANEAKGANLSGKWRGGTGLVTKGADGKVIFLFGETQPSVVC
SPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPGLVTSMVVTTSRRTYHIQL
KSHTSQYMARVGFDYPEDVSSKLADVNARLEAGRTPGAGVPSEQLTFAYSVSGKASWKPMRVYSDGLKTY
IQFPRSIAGQDAPVLFVVSGGQNRVVNYRMKNDMMVVDYNIDRAVLISGVGKHKQKITIRRGG
 
Nucleotide Sequence: 822 bp     [Download]
>gi|241518161|ref|NC_012853.1|:75355-76176 Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence
ATGAGAAGAGCAACATATCTCGCGGCCCTTGGCTGCGCCTGGGTCGTCGTCTTTGCGACAAACGAAGCCA
AGGCGCAGAGCATGACCGCAAACGAAGCAAAGGGCGCGAACCTCTCAGGAAAGTGGCGCGGGGGCACGGG
GCTCGTCACCAAGGGGGCGGATGGAAAGGTCATCTTCCTGTTTGGAGAAACTCAGCCGTCGGTGGTGTGT
TCGCCGCTGCAGGTCTGCGACATCGAGCTTCAGGGCGGCGAGGTCGTTCGCGATGTGCTTGTCGGCGACA
CCGTTCGATGGAAGGTCGAACCGGCAACGTCCGGCGCCGCGGGCGGCCAGGCGATCCACCTCATCGTCAA
ACCGTCGGAACCAGGCCTCGTCACCTCCATGGTGGTGACGACCTCGCGCCGGACCTATCATATCCAGCTC
AAATCACACACGAGCCAGTACATGGCGCGCGTCGGCTTCGACTATCCGGAGGATGTGTCGAGCAAGCTTG
CCGATGTCAACGCCCGTCTCGAAGCTGGAAGGACGCCGGGAGCAGGCGTCCCGTCGGAGCAATTGACCTT
CGCCTATTCGGTTAGCGGCAAAGCCTCGTGGAAGCCCATGCGCGTCTATTCGGACGGCCTGAAGACCTAC
ATCCAGTTTCCCCGCTCGATCGCCGGTCAGGACGCGCCGGTGCTTTTTGTCGTCTCAGGCGGCCAAAATC
GGGTCGTCAACTACCGTATGAAGAACGACATGATGGTAGTGGACTATAATATCGACCGCGCGGTTCTCAT
CTCCGGTGTTGGAAAGCACAAACAGAAGATCACCATTCGCAGGGGAGGGTGA
 Primer design