SecReT4
Protein ID: 241589609
T4SS name [ID]Trb [787]
Gene symbol-
Locus tagRpic12D_4745
StrainRalstonia pickettii 12D
Repliconplasmid pRp12D01 [GenBank: NC_012855] [Browse all T4SS(s) in this replicon]
Location [Strand]89928..90287 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDC6BQD3
KEGG IDrpf:Rpic12D_4745
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8e-16, Aligned region: 12..107
Protein Sequence: 119 a.a.     [Download]
>gi|241589609|ref|YP_002979634.1| Conjugal transfer protein TrbC [Ralstonia pickettii 12D]
MKLLMSHLSVFNAISQKQRKWAAFALLSAMAVSSTPALAVMTLPITGILCDFFHLMTGPVGYAISGIVVV
ILGLLWAAGEVSGWIGRGLAVIVGISIALQAATWLGAIQTSGGAAGSGC
 
Nucleotide Sequence: 360 bp     [Download]
>gi|241589533|ref|NC_012855.1|:89928-90287 Ralstonia pickettii 12D plasmid pRp12D01, complete sequence
ATGAAACTTTTGATGTCCCACTTGTCGGTATTCAACGCGATCTCGCAGAAGCAGCGTAAATGGGCGGCGT
TCGCATTGCTGTCGGCCATGGCAGTTTCCTCCACGCCGGCCCTCGCAGTAATGACGCTCCCGATCACGGG
CATTCTGTGCGATTTCTTCCACCTGATGACGGGGCCCGTGGGCTACGCGATCTCCGGGATCGTCGTGGTG
ATTCTGGGCTTGCTGTGGGCGGCGGGTGAGGTGAGCGGTTGGATCGGCCGCGGCTTGGCCGTTATTGTCG
GCATCTCCATCGCATTGCAAGCAGCTACCTGGTTGGGCGCGATCCAAACCTCGGGTGGTGCTGCCGGCAG
CGGCTGCTAA
 Primer design