SecReT4
Protein ID: 241589619
T4SS name [ID]Trb [787]
Gene symbol-
Locus tagRpic12D_4755
StrainRalstonia pickettii 12D
Repliconplasmid pRp12D01 [GenBank: NC_012855] [Browse all T4SS(s) in this replicon]
Location [Strand]99559..100326 [+]
ProductConjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDC6BQE3
KEGG IDrpf:Rpic12D_4755
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.4e-54, Aligned region: 33..251
Protein Sequence: 255 a.a.     [Download]
>gi|241589619|ref|YP_002979644.1| Conjugal transfer protein TrbG/VirB9/CagX [Ralstonia pickettii 12D]
MMSILLKSAAALVVLSASFAVRAELIATPLPGDTRLVRFEFDPNNTYQVLTRPKSVTDIELEPGEVVKGM
AVGDSFSWDCETGVPGHIFVRPKYDDMVTSGTVVTDKRTYQLMLRSTSADVGKWYQRVTWGYPAMSILQP
VATAGVAPQSADTKSPVGSLARGVSVDQLNFDYSISGGAAFRPVQVIDDGTFTWLQMPARLQDWPAVFWV
TPDNRYAALTPVPDGRYLKVTKVVHKLLLKIGKEEVEITNNKVAQ
 
Nucleotide Sequence: 768 bp     [Download]
>gi|241589533|ref|NC_012855.1|:99559-100326 Ralstonia pickettii 12D plasmid pRp12D01, complete sequence
ATGATGTCGATCCTTCTGAAGTCTGCCGCGGCTCTCGTGGTTTTGTCGGCCTCTTTCGCCGTGCGAGCGG
AGCTTATTGCTACCCCGCTTCCTGGTGACACCAGGTTGGTCCGATTCGAGTTTGATCCAAACAACACGTA
CCAAGTGCTTACTCGCCCGAAGTCGGTTACTGACATCGAACTCGAACCGGGGGAGGTCGTGAAAGGAATG
GCAGTCGGGGACTCCTTCTCATGGGATTGTGAGACGGGCGTCCCCGGCCACATATTTGTTCGCCCGAAGT
ACGACGACATGGTGACCTCTGGGACCGTAGTCACGGACAAACGGACCTACCAACTTATGCTGCGATCGAC
GTCAGCTGACGTGGGAAAGTGGTACCAACGCGTGACCTGGGGCTATCCAGCGATGTCGATTTTGCAACCT
GTCGCTACCGCTGGCGTGGCTCCACAGTCGGCTGACACCAAATCTCCCGTAGGCAGCTTGGCTCGTGGTG
TTTCCGTTGACCAACTCAACTTCGACTACTCGATTAGTGGCGGAGCGGCGTTTCGTCCAGTTCAGGTTAT
CGACGATGGGACATTTACTTGGCTGCAGATGCCTGCCAGGTTGCAGGATTGGCCTGCTGTGTTCTGGGTG
ACTCCCGACAATCGGTACGCCGCCCTAACCCCTGTCCCTGATGGCCGGTACTTGAAGGTCACGAAGGTCG
TCCACAAGCTGCTCCTGAAGATCGGCAAGGAAGAGGTCGAGATCACCAACAATAAGGTCGCTCAATGA
 Primer design