SecReT4
Protein ID: 241662284
T4SS name [ID]Tfc [718]
Gene symbol-
Locus tagRpic12D_0671
StrainRalstonia pickettii 12D
Repliconchromosome 1 [GenBank: NC_012856] [Browse all T4SS(s) in this replicon]
Location [Strand]704219..704803 [+]
Productlytic transglycosylase catalytic subunit
Component typeTfc4
UniProt IDC6BE12
KEGG IDrpf:Rpic12D_0671
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|241662284|ref|YP_002980644.1| lytic transglycosylase catalytic subunit [Ralstonia pickettii 12D]
MAAAIALRAGSVALALGLCACASFALAQEVPPPAYQLAAQQAGVPSPVLYAVALQESGARLRGRLIPWPW
TLNVAGRAERYATRAEACAGIRRALARTLANRIDAGLGQVNLGYHAQRYDHPCDLLDPYRNLAIAAEILQ
EQHTPGEDWLVAIGRYHRPAGGAPAARYRRSVHQHLTRVLGPGASIPSARSPMP
 
Nucleotide Sequence: 585 bp     [Download]
>gi|241661625|ref|NC_012856.1|:704219-704803 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGCAGCGGCAATAGCGCTCCGTGCCGGCAGTGTCGCACTGGCCCTCGGGCTCTGCGCCTGCGCGAGCT
TCGCCCTGGCCCAGGAGGTGCCGCCTCCCGCCTACCAGCTCGCCGCGCAGCAGGCGGGCGTGCCGTCGCC
GGTGCTGTATGCGGTCGCGCTGCAGGAGAGCGGTGCCCGGTTGCGCGGCCGCCTGATCCCCTGGCCGTGG
ACGCTCAACGTCGCCGGGCGGGCCGAACGCTACGCCACACGCGCCGAGGCCTGCGCAGGCATACGCCGGG
CGCTGGCCCGGACGCTGGCCAACCGCATCGACGCCGGCCTCGGCCAGGTCAACCTCGGCTACCACGCGCA
GCGCTACGACCACCCCTGCGACCTGCTCGACCCGTACCGCAACCTCGCCATCGCCGCGGAAATCCTGCAG
GAACAGCACACGCCGGGCGAGGACTGGCTGGTCGCCATCGGCCGCTACCACCGTCCCGCGGGTGGCGCGC
CCGCCGCCCGTTACCGCCGCAGCGTCCACCAGCACCTGACCCGCGTGCTAGGGCCGGGCGCCTCCATTCC
CTCAGCCCGGAGCCCCATGCCATGA
 Primer design