SecReT4
Protein ID: 241662287
T4SS name [ID]Tfc [718]
Gene symbol-
Locus tagRpic12D_0674
StrainRalstonia pickettii 12D
Repliconchromosome 1 [GenBank: NC_012856] [Browse all T4SS(s) in this replicon]
Location [Strand]707539..708288 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDC6BE15
KEGG IDrpf:Rpic12D_0674
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7.2e-68, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|241662287|ref|YP_002980647.1| hypothetical protein Rpic12D_0674 [Ralstonia pickettii 12D]
MSDPAVAVQRQQVRQQGLIASLVTLPFRLFGVLCGSLLLCIVIECIGMHFLWPEQGWRHAQGMLNYELSQ
VSEHFTRSVLVQEPGRSARQLVEWAYQGLFVKTGLLDWIRDAASQSRAGARSQVQDFRYYLGQVYVHVES
YLIASAYTVLVFLVRLLVLILILPLFLMAAFVGLVDGLVRRDVRGFGAGRESGFVYHRARASLMPLAVLP
WVTYLALPVSVHPLLILLPSAALLGVAVAISAATFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|241661625|ref|NC_012856.1|:707539-708288 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGAGCGACCCCGCCGTCGCCGTCCAGCGCCAGCAGGTCCGCCAGCAGGGCCTGATCGCCAGCCTGGTCA
CGCTGCCGTTCCGGCTGTTCGGCGTGCTGTGCGGCTCACTGCTGCTGTGCATCGTGATCGAGTGCATCGG
CATGCACTTCCTTTGGCCCGAACAGGGCTGGCGCCACGCGCAGGGCATGCTGAACTACGAGCTGTCACAG
GTCTCGGAGCATTTCACGCGCAGCGTGCTGGTGCAGGAACCGGGGCGTAGTGCACGGCAGCTCGTCGAGT
GGGCCTACCAAGGGCTGTTCGTGAAGACGGGGCTGCTGGACTGGATACGCGATGCCGCCTCGCAATCCCG
TGCCGGCGCCCGCAGCCAGGTGCAGGACTTCCGCTACTACCTCGGACAGGTCTACGTGCACGTGGAGAGC
TACCTGATCGCCTCGGCCTACACCGTGCTGGTGTTCCTCGTGCGGCTGCTGGTGCTGATCCTGATCCTGC
CGCTGTTCCTGATGGCTGCTTTCGTCGGCCTGGTCGATGGGCTGGTGCGCAGGGACGTGCGCGGCTTCGG
CGCCGGGCGCGAATCGGGCTTCGTCTACCACCGGGCCAGGGCCAGCCTGATGCCGCTGGCGGTGCTGCCC
TGGGTCACGTACCTCGCGCTGCCGGTCAGCGTGCATCCGCTGCTGATCCTGCTGCCCAGCGCGGCGCTGC
TGGGCGTTGCCGTGGCCATCTCCGCGGCCACCTTCAAGAAGTACCTGTAG
 Primer design