SecReT4
Protein ID: 241662288
T4SS name [ID]Tfc [718]
Gene symbol-
Locus tagRpic12D_0675
StrainRalstonia pickettii 12D
Repliconchromosome 1 [GenBank: NC_012856] [Browse all T4SS(s) in this replicon]
Location [Strand]708403..708789 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDC6BE16
KEGG IDrpf:Rpic12D_0675
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.1e-31, Aligned region: 36..114
Protein Sequence: 128 a.a.     [Download]
>gi|241662288|ref|YP_002980648.1| hypothetical protein Rpic12D_0675 [Ralstonia pickettii 12D]
METSRSPAHVRRHAIAALLAALLLAAAGLQPAVAADAADNAAEREMLAAVTRQLELLDRLAERGATTAPQ
ERSRYHFDYARLRADLQRMRAGVRDYLVPQRAQPRDPVPLAGDYTRSGAASDKEAPSP
 
Nucleotide Sequence: 387 bp     [Download]
>gi|241661625|ref|NC_012856.1|:708403-708789 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGAAACCTCCCGCAGTCCTGCGCATGTCCGGCGCCACGCCATCGCCGCGCTATTGGCCGCGCTCCTGC
TCGCCGCTGCGGGGCTTCAGCCGGCCGTCGCCGCCGATGCAGCCGACAACGCCGCAGAGCGCGAGATGCT
CGCCGCGGTGACGCGCCAGCTCGAACTGCTGGACCGCCTCGCCGAACGCGGAGCCACCACCGCACCGCAG
GAGCGGTCCCGCTACCACTTCGACTACGCCCGGCTGCGCGCCGACCTGCAGCGCATGCGCGCAGGCGTGC
GGGACTACCTCGTTCCCCAGCGCGCCCAGCCGCGCGATCCCGTGCCGCTGGCCGGCGACTACACGCGCAG
CGGTGCGGCCAGCGACAAGGAGGCGCCGTCGCCATGA
 Primer design