SecReT4
Protein ID: 241662291
T4SS name [ID]Tfc [718]
Gene symbol-
Locus tagRpic12D_0678
StrainRalstonia pickettii 12D
Repliconchromosome 1 [GenBank: NC_012856] [Browse all T4SS(s) in this replicon]
Location [Strand]709427..709855 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDC6BE19
KEGG IDrpf:Rpic12D_0678
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.8e-47, Aligned region: 12..132
Protein Sequence: 142 a.a.     [Download]
>gi|241662291|ref|YP_002980651.1| hypothetical protein Rpic12D_0678 [Ralstonia pickettii 12D]
MAGALESPPRDGLVTFMPHRLNRHPVVVRGLTADELWVCAGLSGAVGFVAGVPLAWLTHSIAMVPTLVVA
GIGIGVFVGGGLLRRWKRGRPDTWLYRQLQWRLALRYPALAAHAGGGQLITRSGWWTTRRQRSGLAAHRG
TA
 
Nucleotide Sequence: 429 bp     [Download]
>gi|241661625|ref|NC_012856.1|:709427-709855 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGGCTGGCGCCCTGGAGAGCCCGCCGCGCGACGGGCTCGTGACCTTTATGCCGCATCGCCTCAACCGCC
ATCCGGTGGTCGTGCGCGGGCTCACGGCCGACGAGCTGTGGGTCTGCGCCGGCCTGTCGGGCGCGGTCGG
GTTCGTGGCCGGCGTGCCGCTGGCCTGGCTGACCCACAGCATTGCGATGGTGCCCACGCTGGTCGTTGCC
GGCATCGGCATCGGCGTCTTCGTGGGCGGCGGTCTGTTGCGGCGGTGGAAGCGCGGCCGGCCCGACACCT
GGCTGTACCGCCAGCTCCAGTGGCGGCTCGCGCTGCGCTATCCCGCGCTGGCGGCCCACGCGGGCGGCGG
CCAGCTCATCACCCGCTCGGGCTGGTGGACCACGCGCCGCCAGCGGTCCGGCCTAGCCGCTCACCGAGGT
ACAGCATGA
 Primer design