SecReT4
Protein ID: 241662301
T4SS name [ID]Tfc [718]
Gene symbol-
Locus tagRpic12D_0688
StrainRalstonia pickettii 12D
Repliconchromosome 1 [GenBank: NC_012856] [Browse all T4SS(s) in this replicon]
Location [Strand]719224..720627 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDC6BE29
KEGG IDrpf:Rpic12D_0688
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 467 a.a.     [Download]
>gi|241662301|ref|YP_002980661.1| hypothetical protein Rpic12D_0688 [Ralstonia pickettii 12D]
MKASLSRFAQRARPYALSIALACAVTAAAGVAWAQTRIGPTGVGVSGSVIGDDVLYSIGGGRAVSMGGAG
NMQSIGVGIGWNSNLICGNMSITTTLQNQLNGLTNGFQQIMSSVIQSATSAVASLPALIIQRADPGLYNL
LTNGVLQARLDFDRSKLTCKAMANRMADMAGGQAGWDQLAEGFALRDAVSSTDAVSAVEQAESNKGNNGV
PWVGGGNAGGSGQGSIKVVGDVTRAGYNLLNSRGVSDTSSIPRASCGNRLTCQTWSSPQAAADFATRVLG
EREQRTCETCTKTQTTPGVGLTPVIQEEYETKLQALQELVTGAKPTTVANLEAAGSNSLPITRGVIEALR
DEPDQDLLGKRLASEAALSSVLEKALLLQRTLLTGKKEPNVAANELAVKAVDQENTALEQEINNLKTELE
LRRTLAGNSAMAIVQRHGTRAAGSRGIFEGDTTRDRLKEVQKPRSGP
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|241661625|ref|NC_012856.1|:719224-720627 Ralstonia pickettii 12D chromosome 1, complete sequence
ATGAAAGCGTCCCTTTCCCGTTTCGCACAGCGCGCCAGGCCCTACGCGCTCAGCATCGCGCTCGCCTGCG
CCGTCACGGCCGCAGCCGGCGTCGCCTGGGCGCAGACCCGCATCGGCCCCACCGGCGTCGGCGTGAGCGG
CAGCGTCATCGGCGACGACGTGCTCTACAGCATCGGCGGCGGCCGGGCCGTGTCCATGGGCGGCGCCGGG
AACATGCAGAGCATCGGCGTGGGCATCGGCTGGAACAGCAACCTGATCTGCGGAAACATGAGCATCACGA
CGACGCTGCAGAACCAGTTGAACGGCCTCACCAATGGCTTTCAGCAGATCATGTCCTCGGTGATCCAGAG
CGCCACCAGCGCCGTGGCGTCGCTGCCGGCCCTGATCATCCAGCGTGCCGATCCGGGCCTCTACAACCTG
CTGACCAACGGCGTGCTGCAGGCGCGGCTCGATTTCGACCGCAGCAAATTGACGTGCAAGGCGATGGCCA
ACCGGATGGCGGACATGGCCGGCGGCCAGGCCGGGTGGGATCAGCTCGCCGAAGGTTTCGCGCTGCGCGA
TGCGGTGAGCAGCACCGATGCGGTGTCCGCCGTCGAGCAGGCCGAATCGAACAAGGGCAACAACGGCGTG
CCCTGGGTGGGCGGCGGCAACGCGGGCGGCTCGGGCCAGGGTTCCATCAAGGTGGTCGGTGATGTGACCC
GTGCCGGCTACAACCTGCTCAACAGTCGCGGTGTCAGCGACACCTCATCCATCCCGCGCGCGTCCTGCGG
CAACCGGCTGACCTGCCAAACCTGGTCCTCGCCGCAGGCCGCAGCGGACTTCGCGACCCGCGTGCTCGGC
GAGCGCGAGCAACGCACCTGCGAGACCTGCACCAAGACGCAGACGACGCCTGGCGTCGGCCTGACGCCGG
TGATCCAGGAAGAGTACGAGACCAAGCTGCAGGCGCTGCAGGAGCTGGTGACGGGCGCGAAGCCGACGAC
GGTGGCGAACCTCGAAGCCGCCGGCAGCAACTCGCTGCCGATCACGCGCGGCGTGATCGAGGCGCTGCGC
GACGAACCCGATCAAGACCTGCTCGGCAAGCGCCTGGCGTCCGAAGCCGCGCTGTCGAGCGTGCTGGAGA
AGGCCCTGCTGTTGCAGCGCACGCTGCTGACCGGCAAGAAGGAGCCCAACGTCGCCGCCAACGAGCTGGC
CGTGAAGGCCGTCGATCAAGAGAACACCGCGCTGGAGCAGGAGATCAACAACCTCAAGACCGAGCTGGAG
CTGCGGCGCACGCTGGCCGGCAATTCGGCGATGGCGATCGTGCAGCGCCACGGCACCCGCGCCGCGGGCT
CGCGCGGCATCTTCGAGGGCGACACGACGCGCGACCGCCTCAAGGAAGTGCAGAAGCCGCGGAGCGGGCC
ATGA
 Primer design