SecReT4
Protein ID: 242279174
T4SS name [ID]Trb [309]
Gene symbol-
Locus tagDesal_1702
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T4SS(s) in this replicon]
Location [Strand]1866710..1867714 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDC6BT60
KEGG IDdsa:Desal_1702
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.4e-52, Aligned region: 116..329
Protein Sequence: 334 a.a.     [Download]
>gi|242279174|ref|YP_002991303.1| P-type conjugative transfer protein TrbG [Desulfovibrio salexigens DSM 2638]
MKHLILTLSLVLIACSGWAAPNSQQAGQQDPNQGLMNKVFAQHLPPETGNNAAKTDKNPSYSTAVMAQPD
YISKTNVRLNSKEWEALKLSKEWINRKINPILLENGKVVHIFGATMPSIICSPFMTSDLELQPGENVNDV
IVGDTARWMIALSKSGTPGREATHILIKPLDAGLVTTAVIPTDRRVYHLKLVSRRKDYNPYVSFIYPEDQ
QKVLKASLKRKKKKDIWDTTQIEGKTVDLSTLDFSYTISGDDASWKPMRVYNDGIRTFIQLPRTSTQTEI
PVLLVEKAGQEAIVNYRVKGNAFVVDEIFEKAILVAGTGMDQAKVEITRIEVTK
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|242277482|ref|NC_012881.1|:c1867714-1866710 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGAAGCACCTCATTTTAACGTTATCCCTTGTTCTCATCGCCTGTTCCGGCTGGGCTGCACCTAATTCGC
AGCAAGCCGGACAGCAAGATCCTAATCAGGGATTGATGAACAAGGTATTTGCACAACATTTACCGCCGGA
AACCGGAAATAATGCAGCCAAAACGGATAAAAATCCGTCTTATTCGACTGCTGTGATGGCGCAGCCGGAT
TACATCTCTAAAACAAACGTTCGTCTTAATAGCAAAGAATGGGAAGCTCTGAAGCTTTCCAAGGAATGGA
TCAACCGCAAGATTAACCCGATCCTGCTGGAGAACGGCAAAGTGGTTCACATCTTTGGGGCCACCATGCC
GAGCATCATCTGCTCACCGTTTATGACCTCCGATCTAGAGCTTCAGCCCGGTGAAAACGTTAACGATGTG
ATTGTCGGTGATACCGCACGCTGGATGATTGCGCTTAGCAAATCCGGAACTCCGGGCAGGGAAGCCACGC
ATATTCTCATCAAGCCCCTTGACGCTGGGCTTGTGACTACTGCCGTCATTCCAACTGACCGCAGAGTTTA
CCATCTGAAGCTTGTCTCACGCCGCAAGGACTACAATCCATACGTTTCTTTCATCTATCCGGAAGATCAG
CAGAAAGTACTTAAAGCCAGCCTGAAGCGCAAAAAGAAAAAAGACATCTGGGACACCACCCAGATTGAAG
GCAAGACCGTAGATCTTTCCACCTTGGACTTCAGCTACACCATCAGCGGTGATGATGCGAGTTGGAAGCC
CATGCGCGTCTATAATGATGGAATCAGAACATTTATCCAGCTTCCAAGGACTTCCACCCAAACCGAGATC
CCGGTGCTGCTGGTGGAAAAGGCCGGACAGGAAGCTATCGTTAACTATCGTGTCAAAGGCAATGCCTTTG
TCGTTGATGAAATCTTTGAAAAAGCAATCCTCGTGGCCGGAACCGGAATGGATCAGGCCAAAGTGGAAAT
TACACGAATTGAGGTGACCAAATGA
 Primer design