SecReT4
Protein ID: 242279176
T4SS name [ID]Trb [309]
Gene symbol-
Locus tagDesal_1704
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T4SS(s) in this replicon]
Location [Strand]1868402..1869835 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDC6BT62
KEGG IDdsa:Desal_1704
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.9e-12, Aligned region: 156..361
Protein Sequence: 477 a.a.     [Download]
>gi|242279176|ref|YP_002991305.1| P-type conjugative transfer protein TrbL [Desulfovibrio salexigens DSM 2638]
MDSTTIPLLSCIFYQSAAELYQKALFLIAEYLGHQFHPCYLQRKLSYLVQFSQPLFHYMQRENIRKKLSI
NIAYELLTNINNFIISAVIKVNPITTILIAITLVLTMSGLAYATEDITQDLGLSSRLLTEFEAAAKTWGP
AIQGYSLTLFKLLISIELAWLGIQATLKQYDLKQKLAEFVLLIIYGSFMASVIFYSAEWTTSLIKSFSSV
AITAGAQEPDPEIIFFYGLKIIGDLLNNLTVKIHVSIGILICCVILAITFSLMTAQLILVKCESFIVLNA
GAILLGFGGSKFTKDFTINYLKYSLAIAAKLFTLQLLMSLSLNFIAKFTTLNTKCFADIFVVVCSSIIIL
VLIKYLPAKVAEMVNVSQVSGGGALTSAMSAIGITTMTAMQMPAQALGGAVEAKRGMDTLKEAFNMAGSQ
GATGLGKGWQAFKNLGGAARENIGATNMGNLRSTITSHHEAFKMQQPAGPSTNFQLP
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|242277482|ref|NC_012881.1|:c1869835-1868402 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGGACTCAACTACTATTCCTCTGCTTTCTTGTATTTTTTATCAATCAGCTGCTGAACTTTATCAGAAAG
CTCTTTTCCTGATTGCTGAATATCTTGGACATCAATTTCATCCTTGTTATCTACAGAGGAAATTGTCTTA
TCTTGTTCAGTTTTCTCAACCTTTGTTTCATTACATGCAACGAGAGAACATAAGAAAAAAACTATCAATA
AATATCGCATACGAACTCCTTACAAATATTAATAATTTCATAATTAGTGCCGTAATCAAAGTCAATCCAA
TAACAACGATACTGATAGCCATAACTTTGGTTCTTACAATGAGCGGTCTTGCTTACGCGACAGAAGACAT
AACTCAAGATTTAGGACTATCGTCCAGGCTTTTAACTGAATTTGAGGCAGCAGCTAAGACATGGGGGCCA
GCCATACAAGGATACTCCCTGACACTCTTCAAATTACTGATAAGTATTGAACTGGCGTGGTTAGGGATTC
AAGCAACACTTAAGCAATATGACCTCAAACAAAAATTGGCTGAGTTCGTGTTGCTCATTATCTACGGCAG
CTTCATGGCCTCTGTTATTTTTTATAGTGCGGAATGGACTACATCACTAATCAAATCCTTCAGCAGTGTT
GCAATAACAGCAGGCGCACAAGAGCCAGACCCAGAAATAATCTTTTTTTATGGACTAAAGATCATTGGTG
ACTTGTTAAATAACCTGACAGTTAAAATACACGTAAGTATCGGTATTTTAATATGCTGTGTAATCTTAGC
AATCACTTTTTCCTTAATGACCGCCCAGCTAATATTGGTGAAATGTGAGTCATTTATTGTCCTGAATGCA
GGAGCTATTCTGCTAGGTTTTGGCGGTTCAAAATTTACTAAAGATTTCACCATAAATTATCTCAAGTACT
CTTTGGCTATAGCGGCAAAATTATTCACCTTACAGCTCCTGATGAGCTTGAGTTTAAATTTTATTGCCAA
ATTCACAACACTTAACACCAAGTGTTTTGCTGATATTTTCGTCGTCGTCTGCTCATCAATCATCATTCTG
GTTCTCATTAAATACCTTCCTGCAAAAGTAGCTGAAATGGTCAACGTCTCCCAAGTCTCCGGAGGAGGCG
CGCTTACTTCTGCAATGTCTGCGATCGGGATCACAACCATGACGGCAATGCAAATGCCAGCGCAGGCCCT
TGGCGGTGCGGTCGAAGCAAAGCGCGGAATGGACACGCTCAAAGAAGCATTCAACATGGCCGGTTCGCAA
GGGGCAACCGGGCTAGGCAAGGGTTGGCAAGCATTTAAAAACCTTGGCGGTGCGGCTCGGGAGAACATCG
GCGCGACCAATATGGGCAACCTGCGCAGCACCATTACTTCCCATCATGAAGCCTTCAAAATGCAACAACC
AGCTGGACCGTCTACCAACTTCCAGCTTCCCTAA
 Primer design