SecReT4
Protein ID: 242279180
T4SS name [ID]Trb [309]
Gene symbol-
Locus tagDesal_1708
StrainDesulfovibrio salexigens DSM 2638
Repliconchromosome [GenBank: NC_012881] [Browse all T4SS(s) in this replicon]
Location [Strand]1873390..1873701 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDC6BT66
KEGG IDdsa:Desal_1708
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-13, Aligned region: 3..94
Protein Sequence: 103 a.a.     [Download]
>gi|242279180|ref|YP_002991309.1| conjugal transfer protein TrbC [Desulfovibrio salexigens DSM 2638]
MKSNTKITLLLLSAILLFPEIASASGIAEFKGPVEKVLGTVAGPVGGIISAIALAISGLTFILKKAELGE
GFKLFLSIIIGICFVAFASAIVNAVFTFTGAIL
 
Nucleotide Sequence: 312 bp     [Download]
>gi|242277482|ref|NC_012881.1|:c1873701-1873390 Desulfovibrio salexigens DSM 2638 chromosome, complete genome
ATGAAAAGCAATACTAAAATTACCTTACTTCTTTTATCGGCAATTTTACTGTTCCCGGAAATAGCTTCAG
CCAGTGGAATTGCTGAGTTCAAAGGACCTGTTGAAAAAGTATTAGGAACTGTGGCTGGTCCGGTTGGTGG
AATAATCTCTGCTATCGCACTTGCCATTTCGGGTCTCACCTTCATCCTTAAAAAGGCAGAACTGGGCGAA
GGGTTCAAATTATTCCTGAGCATAATCATTGGTATCTGCTTTGTCGCTTTTGCCTCTGCCATAGTGAATG
CCGTTTTTACCTTCACAGGAGCAATCCTGTGA
 Primer design