SecReT4
Protein ID: 242348004
T4SS name [ID]Tra_F [580]
Gene symboltraL
Locus tagpRA1_0067
StrainAeromonas hydrophila plasmid pRA1 (NC_012885)
Repliconplasmid pRA1 [GenBank: NC_012885] [Browse all T4SS(s) in this replicon]
Location [Strand]52112..52393 [+]
Producttype IV secretion-like conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDC6GA24
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.9e-15, Aligned region: 4..79
Protein Sequence: 93 a.a.     [Download]
>gi|242348004|ref|YP_002995565.1| type IV secretion-like conjugative transfer system protein TraL [Aeromonas hydrophila]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVVIGKALVCFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIVTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|242347937|ref|NC_012885.1|:52112-52393 Aeromonas hydrophila plasmid pRA1, complete sequence
ATGAAGCCTGTAAAGATACCGCGTCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGC
TGGCCCCGATGCTTTTGGGGCTAACGATAGGAGTCGTCATCGGTAAAGCTCTGGTCTGCTTTTTAGGGGG
GTTGCTTGTAACCAACCTTTATCGCCGGTTCAGAGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTTATCGTGACCAAGGCCAAATCTCTCAAGAACCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design