SecReT4
Protein ID: 242348084
T4SS name [ID]Tra_F [580]
Gene symboltraF
Locus tagpRA1_0147
StrainAeromonas hydrophila plasmid pRA1 (NC_012885)
Repliconplasmid pRA1 [GenBank: NC_012885] [Browse all T4SS(s) in this replicon]
Location [Strand]131026..132066 [+]
Producttype IV secretion-like conjugative transfer system protein TraF
Component typeTraF_F
UniProt IDC6GAA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.3e-68, Aligned region: 47..276
Protein Sequence: 346 a.a.     [Download]
>gi|242348084|ref|YP_002995645.1| type IV secretion-like conjugative transfer system protein TraF [Aeromonas hydrophila]
MGKYVRETMKRSPLDLLLLAALTLGASHQAWAQYDTRSGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPV
PEAKLTPPMPAAPLPSGPEMFSAEWFRENLPKYKDLAWDNPTVENVRTFLYLQRFAIDRSEQFSDATELA
VVGDPFLDEITRRPAATFASQQVDRDAGNAKNKLLKSVADRVGIFFFYKSDDEYSDLQAPLIKMLEQGEG
FSIIPVSMDGKPLPNGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAK
RNGWVTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIREKLQEN
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|242347937|ref|NC_012885.1|:131026-132066 Aeromonas hydrophila plasmid pRA1, complete sequence
ATGGGAAAATACGTGCGTGAGACTATGAAAAGATCACCTTTGGATTTACTGCTCCTTGCAGCGCTCACGC
TAGGGGCATCACACCAAGCTTGGGCTCAATATGACACAAGATCTGGCTTTTATGAGCGCAAAGAAGAGGG
TTGGTTCTGGTACAAGGAAGAACCAAAAGAGCCGGAGAAGAAGCCAGAAAAGCCCAAACCAAAACCTGTG
CCAGAAGCGAAGCTAACACCGCCGATGCCTGCTGCTCCGCTACCAAGCGGTCCAGAAATGTTTTCGGCAG
AATGGTTCCGAGAAAACTTACCCAAGTACAAAGACCTTGCCTGGGATAATCCTACCGTTGAAAACGTCAG
GACGTTTCTCTACTTGCAGAGATTTGCGATAGATCGCTCTGAACAGTTTTCCGATGCTACAGAGCTGGCG
GTTGTGGGTGATCCGTTCCTGGATGAGATCACTCGACGTCCTGCGGCCACATTTGCCTCACAACAGGTTG
ATCGTGACGCCGGTAATGCCAAAAACAAGCTGCTCAAAAGCGTAGCCGACCGAGTGGGAATCTTCTTCTT
CTACAAGTCCGACGATGAATACAGTGACTTGCAAGCACCGCTAATCAAGATGCTTGAACAAGGAGAAGGC
TTCTCGATCATTCCAGTTTCTATGGACGGCAAACCTCTCCCGAACGGGCTTTTCCCCCACTACAAGACCG
ATGAAGGCCATGCCAAACAACTTGGCATTGTGACCTTCCCTGCTGTTTACCTCGCATCTCCAGACGGTCA
GTTCGCACCTATAGGGCAAGGACCAATGTCTCTTCCTGAGTTGAATCACAGGATTTTGGTCGCCGCAAAA
CGCAACGGCTGGGTCACAGACGAAGAGTTCAATCGTACACGCCCGGTACTCAACCTAGAAAACAACATAG
CCGAACGCTTGGCCTCACCAGAGCTGGGCTCTGACCTCAAGCAGTTATCCCAAGCGAGCGGTGATAAAGA
CAACTTTGTGCCACCGGAGCAACTCATGAAGTACATCCGGGAAAAATTACAGGAGAACTAA
 Primer design