SecReT4
Protein ID: 24378719
T4SS name [ID]Ydd [628]
Gene symbol-
Locus tagSMU_208c
StrainStreptococcus mutans UA159
Repliconchromosome [GenBank: NC_004350] [Browse all T4SS(s) in this replicon]
Location [Strand]204699..206423 [-]
Producttransposon protein
Component typeYdcQ
UniProt IDQ8DW67
KEGG IDsmu:SMU_208c
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 5.9e-23, Aligned region: 207..369
Protein Sequence: 574 a.a.     [Download]
>gi|24378719|ref|NP_720674.1| transposon protein [Streptococcus mutans UA159]
MVRKLFYWVVHDIYTYKGKRVRNWYKYSRSFQIGFFFLPFLAAVGLFLYYHYLQLLQSPLLYLTGSFTVL
LLALICVIIIVLKLEVHVLWFARLRSLFLLRRFLISHNYYETKERTVQREKRTVTKTKIVLPKVYLKQGK
FGVDVYFELQGNAYQEKFLKLGPELETTFGGDFMYRKEIKGYTYYHLAIDRFSSRLNVVDVKVDKKGLRL
MKDVWWDFDSQPHMLVAGGTGGGKTVLLMAIVLGLAEVADVDLCDPKESDLTVLKKAPVFKNRVFYSKED
MVACLRDNVAYMVERYHFMANHPDNRIGKKYSDYGLRPKFIIFDEWAAFMALLDDNMKLSMEVVQLLTQL
ILKGRQAGIFVIEGLQRPDGEFIKTALRDNFMVRVSVGVLEDTGYTMLFGDANRNKIFKNIDEVNGEKVK
GRGYFAHAGTMAGEFFAPFVPFDKGFDFLEAFEAMPVLPDDLVAFPVASTAEALEEAKELPVDTVFEQLP
KKHETLDSLAKRLAKSFNQVKNVVTMIEDGDYYTFARDDAGKYSFTGVESDMIIAIFEAKEASDQRYKTV
IADFFNTSTEDEAA
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|347750429|ref|NC_004350.2|:c206423-204699 Streptococcus mutans UA159 chromosome, complete genome
ATGGTGAGAAAGCTTTTTTATTGGGTAGTTCATGATATTTATACTTATAAAGGGAAACGTGTTAGAAATT
GGTATAAATATAGCAGGAGCTTTCAGATAGGTTTCTTTTTCTTACCTTTTTTAGCTGCTGTTGGTTTATT
TCTTTATTATCATTACCTTCAGCTTTTACAATCTCCTCTTTTGTACTTAACTGGTTCTTTTACTGTTTTA
TTGCTGGCTTTAATATGTGTCATTATCATTGTGTTGAAATTAGAAGTTCATGTGCTTTGGTTTGCTCGAC
TGCGTTCATTGTTTTTGTTACGTCGTTTTTTGATTAGTCATAATTATTATGAAACAAAAGAAAGAACAGT
ACAGAGAGAGAAACGGACGGTTACTAAAACTAAGATTGTTTTGCCTAAGGTTTATTTGAAACAAGGAAAA
TTTGGGGTAGATGTTTATTTTGAATTGCAAGGAAATGCTTATCAAGAAAAGTTTTTGAAGCTTGGGCCAG
AGTTAGAAACAACTTTTGGCGGTGATTTTATGTATCGAAAAGAAATTAAAGGCTATACTTATTATCACTT
AGCTATTGATCGTTTTTCATCTCGGTTAAATGTTGTTGATGTTAAAGTAGATAAAAAAGGGTTACGCTTG
ATGAAAGATGTTTGGTGGGATTTTGATTCCCAACCTCATATGCTTGTGGCTGGTGGTACTGGTGGCGGTA
AAACGGTTTTATTGATGGCTATTGTTTTAGGTTTAGCAGAGGTGGCAGATGTTGATTTGTGTGACCCTAA
GGAGTCAGATTTAACAGTATTGAAAAAAGCACCTGTTTTTAAAAATCGGGTATTTTATAGTAAAGAGGAT
ATGGTTGCATGTCTAAGAGATAATGTGGCTTATATGGTTGAGCGTTACCATTTTATGGCAAACCATCCAG
ATAATCGTATTGGGAAAAAATATTCAGATTATGGTTTGCGTCCTAAGTTTATTATTTTTGATGAATGGGC
TGCATTTATGGCATTATTAGATGATAATATGAAGTTATCTATGGAAGTTGTACAGCTGTTGACTCAGTTA
ATTTTAAAGGGCCGTCAAGCCGGTATTTTTGTGATTGAAGGCCTGCAGCGCCCTGATGGTGAATTTATTA
AAACGGCTTTGAGGGATAACTTTATGGTTCGTGTGTCTGTTGGTGTACTTGAAGATACGGGTTATACTAT
GCTTTTTGGAGACGCTAACCGTAATAAGATTTTTAAAAATATTGATGAAGTTAATGGTGAAAAGGTTAAA
GGTCGTGGTTATTTTGCACATGCTGGTACAATGGCTGGTGAGTTTTTTGCGCCATTTGTACCTTTTGATA
AAGGGTTTGATTTTTTGGAGGCTTTTGAAGCTATGCCTGTATTGCCTGATGATCTTGTCGCTTTTCCTGT
TGCTAGTACTGCTGAGGCATTGGAAGAAGCTAAGGAATTGCCAGTTGATACTGTGTTTGAACAATTACCT
AAAAAACATGAGACTTTGGATAGTCTAGCTAAGCGTTTAGCTAAGAGTTTTAATCAAGTTAAAAATGTTG
TGACTATGATTGAAGATGGCGATTATTATACGTTTGCTCGTGATGATGCCGGTAAATATAGTTTTACAGG
TGTTGAGTCAGATATGATTATTGCTATTTTTGAGGCAAAAGAAGCTAGTGACCAGCGTTATAAGACTGTT
ATTGCTGACTTTTTTAATACTTCTACTGAAGATGAAGCTGCTTAG
 Primer design