SecReT4
Protein ID: 25011179
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1128
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1173758..1175803 [-]
Producthypothetical protein
Component typePcfC
UniProt IDQ8E5A4
KEGG IDsan:gbs1128
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.8e-56, Aligned region: 141..549
TraG-D_C [PF12696], Evalue: 1.9e-34, Aligned region: 410..528
TrwB_AAD_bind [PF10412], Evalue: 1.9e-21, Aligned region: 140..538
AAA_10 [PF12846], Evalue: 1.1e-06, Aligned region: 140..480
Protein Sequence: 681 a.a.     [Download]
>gi|25011179|ref|NP_735574.1| hypothetical protein gbs1128 [Streptococcus agalactiae NEM316]
MELKRKRLLPYLLLSLLLAYLTHRAYVLYCMAPQADMTNLFAPYTYVFEKITEPPYFYWNTSPLAILSAL
VGFFVGLLFYLKIRLDGNYRHGEESGSACFATAQELKGFQDEESRNNMIFSREAQMGLFNKRLPFERQLN
KNVLVAGLPGDGKTYTYVKPNLMQMNSSFIVTDPKGLLVREVGTMLKENGYQIKIFDLVNLTNSDMFNPF
RYMRSELDIDRITEAIVEGTKKGDREGEDFWNQAKLLLNRALLGYLYFDSQVRHYEPNLSMVADLLRNLK
RPNEKELSAVEKMFKQLEEKLPGNYACRQWELFNSNFEAETRTGVLSIVATQYSIFDHDAVTNLIKTDTM
EMDTWNTEKTAVFVAISETNKAYSFLASTFFTVVFDQLTHSADAIIQGEKKGYELKDLLHVQFYFDEFAN
CGKIPHFNEVLASIRSREMSIKIIIQAISQLDSLYGVPARKSMVNNCATLLFLGTNDEDTMKYFSMRAGK
QTIIQTSYSEQRGHRISGTTSRQAHQRDLMTPDEIARIGVDEALVFISKQNVFRDKKAMVSNHPMKDRLA
NHYQDKTWYHYKRFMEEGAEFIDAVMTGQIPEDRIWAPDMSDYQAFLEENGFDNTRQSAPETSVHNQVPV
TNPEMPSESPSQTSETSKKLVDMDTGEIFELPPEDREGFGEVSFDDQRVEI
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1175803-1173758 Streptococcus agalactiae NEM316, complete genome
ATGGAACTAAAACGTAAACGATTGCTTCCCTATCTTCTGCTCAGTTTGCTTCTAGCCTACCTGACACATC
GTGCTTATGTCCTTTACTGTATGGCACCACAGGCAGATATGACCAATCTTTTTGCTCCCTATACCTATGT
TTTTGAAAAGATAACGGAACCACCTTACTTCTATTGGAATACTAGCCCACTAGCAATTCTTTCTGCTCTA
GTGGGCTTTTTTGTTGGCTTACTTTTCTATCTAAAGATTAGATTAGATGGTAATTATCGGCATGGAGAAG
AATCAGGGTCTGCTTGCTTTGCGACGGCTCAAGAACTCAAAGGATTTCAAGATGAAGAATCAAGAAATAA
TATGATTTTCTCGAGAGAAGCTCAAATGGGACTCTTCAATAAGCGCTTGCCGTTTGAGCGACAACTCAAT
AAAAATGTCTTAGTAGCTGGTCTGCCTGGAGATGGAAAAACCTACACCTATGTAAAGCCAAACCTCATGC
AAATGAATTCTTCTTTTATCGTAACGGACCCTAAAGGGTTGCTTGTCCGAGAAGTAGGAACAATGTTAAA
AGAAAATGGCTATCAAATCAAAATCTTTGATCTGGTTAACTTAACCAATTCGGATATGTTTAACCCCTTT
AGGTATATGAGATCAGAATTGGATATTGATCGCATTACAGAAGCCATTGTCGAAGGGACAAAAAAGGGAG
ATCGAGAAGGAGAGGACTTCTGGAATCAGGCCAAGCTTCTTTTGAACCGTGCTTTACTTGGCTATCTCTA
TTTTGATAGCCAAGTACGGCATTATGAACCTAACCTTTCTATGGTGGCAGATTTACTTAGAAATTTGAAA
CGCCCTAATGAAAAGGAACTCAGTGCAGTTGAGAAGATGTTTAAGCAATTGGAAGAAAAATTACCAGGTA
ACTATGCCTGTCGACAGTGGGAACTCTTTAACAGTAACTTTGAGGCAGAAACCAGGACTGGTGTCTTATC
TATTGTGGCCACTCAGTACTCCATTTTTGATCATGATGCTGTAACAAATCTCATTAAGACTGACACCATG
GAAATGGATACTTGGAATACCGAAAAGACAGCGGTCTTTGTGGCCATTTCAGAAACTAATAAGGCTTATA
GCTTCTTGGCTTCCACATTCTTTACAGTTGTTTTTGACCAATTGACTCATAGTGCAGATGCTATTATTCA
AGGGGAAAAGAAAGGCTATGAACTGAAAGATTTATTACACGTGCAATTCTACTTCGATGAATTTGCCAAT
TGTGGTAAGATTCCACACTTTAACGAAGTCCTAGCCTCTATTCGTAGCCGTGAGATGTCTATAAAAATCA
TCATTCAAGCCATTAGCCAACTAGATTCCCTATATGGCGTTCCTGCTAGAAAATCCATGGTCAATAACTG
TGCGACGCTTTTATTTTTAGGAACCAATGATGAAGATACTATGAAATACTTCTCCATGCGAGCAGGAAAA
CAAACCATTATACAAACCAGCTATTCGGAACAACGTGGACATCGGATATCAGGGACAACCAGTAGACAAG
CGCATCAACGGGATCTCATGACCCCAGATGAAATAGCTCGTATTGGTGTCGATGAGGCCTTAGTTTTTAT
CTCCAAGCAAAATGTCTTTCGAGATAAGAAAGCCATGGTATCAAATCATCCTATGAAGGATAGACTCGCT
AATCATTATCAAGATAAGACCTGGTATCACTATAAACGCTTTATGGAAGAAGGTGCGGAATTTATTGATG
CAGTCATGACAGGACAAATTCCAGAAGACCGCATTTGGGCTCCTGATATGTCTGACTACCAAGCCTTCTT
AGAAGAAAACGGCTTTGATAACACACGTCAATCAGCTCCTGAGACGTCAGTTCATAACCAAGTCCCTGTA
ACTAATCCTGAAATGCCTTCAGAAAGCCCCTCTCAGACATCCGAAACCTCTAAAAAACTAGTGGATATGG
ATACTGGAGAGATTTTTGAACTTCCCCCTGAAGATCGAGAAGGTTTCGGAGAGGTTTCTTTTGATGACCA
ACGAGTGGAAATCTAG
 Primer design