SecReT4
Protein ID: 25011183
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1132
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1177390..1177995 [-]
Producthypothetical protein
Component typePrgL
UniProt IDQ8E5A0
KEGG IDsan:gbs1132
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 201 a.a.     [Download]
>gi|25011183|ref|NP_735578.1| hypothetical protein gbs1132 [Streptococcus agalactiae NEM316]
MIDTFKVKWFKRGMSLLVLILVFFLGLGFGQMGNSSQSKDRPKQTATKKTRTNTITQTQVKEFLVAYYTK
KDLEENRNRYKDYMTEGLYNATISEENKAQNQAYRGFVVNFEFQDANIYIDQVHKQVICEVTYTNDLLQK
KNNKDGAQIGVVNHTTIQLAYTKLNGKYLINQMSTILLTDSANPSEETESYGAIAPSNTKD
 
Nucleotide Sequence: 606 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1177995-1177390 Streptococcus agalactiae NEM316, complete genome
ATGATTGATACTTTTAAAGTCAAGTGGTTTAAACGTGGCATGAGTCTTCTTGTTCTCATTCTTGTCTTCT
TTTTAGGACTTGGTTTTGGCCAGATGGGAAACTCAAGCCAGTCCAAGGATAGACCTAAACAGACAGCCAC
TAAGAAAACAAGGACGAATACTATTACACAAACACAGGTAAAAGAATTTTTGGTTGCTTACTATACCAAA
AAAGATTTAGAAGAAAACCGTAACCGCTATAAGGACTATATGACAGAGGGTCTCTATAATGCGACGATCT
CAGAAGAAAATAAAGCCCAAAATCAGGCCTACAGAGGCTTTGTAGTTAATTTTGAGTTTCAAGACGCCAA
TATCTATATTGACCAAGTCCATAAACAGGTCATCTGTGAGGTCACCTATACTAATGACTTGCTTCAAAAA
AAGAATAACAAAGACGGTGCTCAAATAGGTGTTGTCAATCATACAACCATTCAGTTAGCTTATACTAAGC
TGAATGGGAAATATTTGATTAACCAGATGAGTACGATCTTGTTAACAGATTCAGCTAATCCTTCTGAAGA
AACTGAAAGTTATGGAGCAATCGCCCCATCAAACACTAAAGATTAA
 Primer design