SecReT4
Protein ID: 25011184
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1133
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1178016..1180706 [-]
Producthypothetical protein
Component typePrgK
UniProt IDQ8E599
KEGG IDsan:gbs1133
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 6.8e-23, Aligned region: 781..879
Peptidase_M23 [PF01551], Evalue: 5.2e-07, Aligned region: 421..494
Protein Sequence: 896 a.a.     [Download]
>gi|25011184|ref|NP_735579.1| hypothetical protein gbs1133 [Streptococcus agalactiae NEM316]
MTEEKQDLRSRVVRKRQIKESVHRHNQSSARKAQKAAKGELQVATKELKEAREAYQKAQTDFRAGIIDDE
ALKKAQEKLKQAQAKYKDAKKVKKKVRKTNPTLSQKVRQTGRRITKRTGQEILEMGFEQDDTLSDLVRTK
HQIRQTQAMAKQAGRATGKGIKLTYRGAKGTVKLGAKGTKYAYHQTRKGSVKATQETVKVASKTAQTLVA
TSKALVSAIAPIIANPITWAVTGVISLLLLIVILVSSVFSSNVVQQNEFTLNQSWLHISKVDRQKSSDKV
DYYTDIDSILLYMNYRYGGEWEPDARWDDGFGGKVTGALGFNHFSDALDDIWKEENQDIDHLKTMAELYT
NGKEWIKFSKDDLEEYKEILDSQAETGKYLAYQELSNPFYASDDDKAESDYLTIAKRYGYTDKDTIDPTT
TLQAKASQKLYAVMDGKVTVTKKDLKGEKTKTTNLIIEDTDARFIYYDVSQSRVKTGDKVEAGRELATVS
GDTQKIAYAKRYGEVDDKDSTWLKEIRDKDVSYGYITKTKKGKKEVWVLTNPGFYFPFVKYVETTTVTQE
PYEMSGRAKQLYDLIKKILPHATDNGIAAIAGCFGVESSINPKRAEGDYLSPPVGSSASSWDDEAWLTIG
GPAIYGGGYPNIIHRGLGLGQFTDTSDGANRNTLLREFAKSKGKKWYSLELQVQFMLEGDNPYYINIFKR
IATSQGDVDSLTAEFLAKWEGVPGNKLAQRQAIAKQALMWFKQPTHSGGASTLQSSWNFPKEYSSKLKSY
PSAATVSRSLNGNTYPIGQCTWYVYNRLSEAGAPAVNWLGNGQDWVRNLVAKGWTFSNKPVAGAVCSTAG
GFDYTMPTYGHVSYVEHVNGDGTFLVSECNVMGIQNQIHWAVKSRQSYYTFAIPPK
 
Nucleotide Sequence: 2691 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1180706-1178016 Streptococcus agalactiae NEM316, complete genome
GTGACAGAAGAAAAACAAGACCTTAGAAGTCGAGTGGTAAGAAAGCGTCAAATTAAAGAAAGTGTCCACA
GACATAACCAGTCTTCCGCTAGAAAAGCGCAAAAAGCAGCGAAAGGAGAGCTTCAAGTAGCCACTAAAGA
GTTAAAAGAAGCTAGAGAAGCCTATCAAAAAGCACAAACAGACTTTAGGGCTGGAATAATAGACGACGAA
GCGCTTAAAAAAGCTCAGGAGAAGCTAAAACAAGCTCAAGCTAAGTATAAGGATGCTAAAAAAGTCAAAA
AGAAAGTACGCAAAACCAATCCAACTCTTAGTCAAAAAGTCAGACAGACAGGTAGGCGTATCACTAAACG
AACAGGTCAAGAAATCCTAGAAATGGGGTTCGAACAAGATGATACTTTATCTGATTTGGTGAGGACTAAA
CATCAGATTCGTCAAACCCAAGCGATGGCTAAACAAGCAGGACGTGCAACCGGTAAAGGTATCAAATTGA
CCTATCGTGGTGCCAAGGGAACGGTAAAACTAGGAGCTAAAGGAACTAAGTACGCCTATCATCAAACACG
AAAAGGAAGCGTAAAAGCTACTCAAGAAACGGTTAAAGTGGCTTCTAAAACCGCTCAAACTCTTGTGGCT
ACTTCAAAAGCTTTAGTGAGTGCTATTGCACCCATTATTGCTAATCCGATAACCTGGGCTGTGACTGGAG
TCATCAGCTTGCTTTTGTTAATCGTTATCCTGGTATCTTCGGTCTTTTCGAGTAATGTGGTCCAACAAAA
TGAATTTACTCTCAATCAATCCTGGCTTCATATTTCAAAGGTAGACCGTCAGAAGTCTTCTGATAAGGTG
GATTACTATACCGATATTGATTCCATCTTACTCTATATGAATTACCGCTATGGTGGAGAGTGGGAACCTG
ATGCCAGGTGGGACGATGGCTTTGGTGGGAAAGTCACAGGTGCTTTAGGTTTCAATCACTTCTCAGATGC
CCTAGATGATATTTGGAAGGAAGAAAACCAAGATATTGATCACCTAAAAACCATGGCCGAACTCTATACC
AATGGGAAAGAGTGGATCAAGTTCTCAAAAGATGATCTTGAGGAATATAAGGAGATTCTAGATAGTCAAG
CCGAGACGGGAAAATATTTAGCTTATCAAGAACTTTCTAATCCCTTTTATGCTTCAGACGATGATAAAGC
AGAATCGGACTACCTAACCATCGCCAAACGCTATGGCTATACCGATAAGGATACCATTGATCCGACGACG
ACACTTCAAGCAAAAGCCAGTCAAAAGTTGTATGCGGTTATGGATGGTAAGGTAACTGTTACCAAAAAAG
ACTTAAAGGGTGAGAAAACGAAAACCACTAATCTGATCATTGAAGATACAGATGCTCGCTTTATCTATTA
TGATGTCTCACAGAGTCGAGTAAAAACGGGAGACAAGGTCGAAGCAGGTCGAGAATTAGCTACGGTATCA
GGCGACACCCAGAAAATAGCTTATGCCAAACGTTATGGGGAAGTAGATGATAAAGACTCTACTTGGTTAA
AAGAGATTCGAGATAAGGATGTTTCTTATGGTTATATCACTAAAACAAAGAAAGGTAAGAAAGAGGTTTG
GGTCTTAACCAACCCAGGTTTTTATTTCCCTTTCGTCAAGTATGTGGAAACCACTACGGTAACCCAAGAA
CCCTATGAAATGAGCGGCCGAGCTAAACAGCTCTATGATTTGATTAAGAAGATCCTACCTCATGCGACGG
ATAATGGCATTGCGGCCATTGCAGGCTGTTTTGGGGTAGAATCTAGTATTAATCCTAAACGTGCCGAAGG
CGATTATCTCAGTCCCCCTGTTGGTTCCTCTGCCTCCTCTTGGGATGATGAGGCTTGGTTAACCATAGGA
GGTCCAGCTATCTACGGCGGTGGCTACCCGAATATCATTCATCGAGGTCTAGGTTTAGGACAGTTTACCG
ATACCTCTGACGGGGCGAATCGGAATACCTTGCTTAGGGAATTTGCGAAAAGTAAAGGTAAGAAATGGTA
CTCTTTGGAGCTACAAGTGCAATTCATGCTAGAAGGTGATAATCCCTATTATATTAATATCTTTAAACGC
ATTGCGACCAGTCAAGGTGATGTGGATAGCTTAACAGCTGAGTTCTTAGCCAAATGGGAAGGCGTACCAG
GAAATAAATTAGCTCAACGTCAAGCTATCGCTAAACAAGCTTTAATGTGGTTTAAACAGCCAACACACTC
AGGTGGTGCAAGCACTCTTCAAAGTTCTTGGAATTTTCCTAAAGAATATTCTTCTAAACTAAAGAGCTAT
CCATCGGCTGCTACTGTATCTAGGTCACTAAATGGCAATACTTATCCAATTGGTCAGTGTACCTGGTATG
TTTATAACCGCCTTTCAGAAGCTGGTGCTCCAGCTGTTAATTGGCTGGGGAACGGCCAAGATTGGGTTAG
AAATTTAGTCGCTAAAGGGTGGACCTTTAGTAATAAACCAGTAGCAGGTGCTGTTTGTTCAACTGCTGGT
GGTTTTGACTACACCATGCCTACTTATGGACACGTATCCTATGTCGAGCATGTCAATGGAGATGGCACCT
TTTTAGTGAGTGAATGTAATGTCATGGGGATTCAAAACCAGATTCATTGGGCAGTGAAATCTAGGCAAAG
CTATTACACTTTTGCAATACCTCCCAAATAA
 Primer design