SecReT4
Protein ID: 25011186
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1135
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1181463..1183853 [-]
Producthypothetical protein
Component typePrgJ
UniProt IDQ8E597
KEGG IDsan:gbs1135
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.5e-42, Aligned region: 457..747
DUF87 [PF01935], Evalue: 1e-08, Aligned region: 457..537
Protein Sequence: 796 a.a.     [Download]
>gi|25011186|ref|NP_735581.1| hypothetical protein gbs1135 [Streptococcus agalactiae NEM316]
MVRLFPKRASRNGMTLTKTEKERAKQLQRALKASTQNTIQYTSLFEDGLMHIVDESYSKTWQLGDTNYIT
GSEDEKLDIIEYYVDALNGLDSENTYQLTILNRPVPTTLLDQITYDLEGDERDVFRKEYNNIIRSRFAKD
QNNFKVEKFVTVSTRAKDRKQAYRKLNDVDTHFTTQFQLVDVLLKSLDGTERLNIFADLLRGNPYLDVDY
KDVRISGLSTKSFIAPGRLWFQPDQFMMDKKYCKILFPRTFPAFLNDRLIKSLTDIGIELAISIHAQPYD
VAEAVKKVNTAEAGVKMDMVKSQVSAAQKGISSNLAVSSVAQDTADEAEKWKTEINDNDQKMFSGVFLVM
VKADSAEELADYTSRIKQAGRKHVIEFEETYYHQEEALNSMLPIGKTYIDVKRRFMRDMTTTNIATQIPF
TNTDLQSQSPLANYYGQNQISNNIISLDRQRDLYTSSGVILGSSGSGKSVFVKINEVIPAILRFPNDRVI
IVDPEEEYVDIGHAFGAQVIDIYPGTKTHFNLMDIPDLNKLRDEDKDFVGQKASLIMGLFENILQEVTDD
DVSLIDRVTHLCYEQITDRTPTLKDWHDILLEQPEEEAQSLALKSESYTKGSQDIFAYETNVDLNNQVVI
FNLKKLSGKLKPFAMMVIQDYIWQHVVDHKDEFVTRVYFDEMQNQFETDDQAAFFSKMYARIRKYGSIPT
GITQNVETLLSRKEGRNLLYNSEFLVLLKQKKTTIPYLLKTINLTDALVRYIEKPKAIGTGLIIAGTTTV
PFENPIPEDTELFRLVATDAYRKMES
 
Nucleotide Sequence: 2391 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1183853-1181463 Streptococcus agalactiae NEM316, complete genome
ATGGTGCGTTTATTCCCCAAAAGGGCATCCAGGAATGGAATGACCCTAACGAAAACTGAAAAAGAACGAG
CAAAACAATTACAGAGAGCTCTGAAGGCTAGTACACAAAATACAATTCAGTACACCTCTTTATTCGAAGA
TGGACTCATGCACATTGTCGATGAATCCTATTCCAAGACTTGGCAATTAGGTGATACGAATTACATCACA
GGTAGTGAAGATGAGAAACTAGATATTATTGAATATTATGTCGATGCTCTAAATGGTCTAGATAGTGAAA
ATACTTATCAGTTGACAATTCTTAATCGTCCTGTGCCTACAACCTTACTGGATCAGATTACCTATGACTT
AGAAGGTGATGAACGAGATGTCTTTCGGAAAGAATACAATAATATTATCCGTTCTCGCTTTGCAAAAGAT
CAAAATAACTTTAAAGTGGAAAAATTTGTGACGGTCTCGACAAGGGCTAAAGATCGAAAACAAGCTTACC
GTAAGTTAAATGATGTTGATACCCATTTTACAACACAGTTTCAATTAGTTGATGTCCTTCTCAAGTCGTT
AGATGGGACAGAAAGGCTCAATATCTTTGCGGATTTACTGAGAGGGAATCCTTATCTCGATGTGGACTAT
AAGGATGTGAGAATTTCAGGTCTGAGCACTAAATCCTTCATCGCTCCTGGTCGTCTTTGGTTTCAACCGG
ACCAGTTTATGATGGATAAGAAATATTGTAAGATTCTCTTTCCCAGAACTTTCCCAGCCTTCCTTAATGA
CCGACTCATTAAATCCTTAACAGACATTGGGATTGAATTAGCTATTTCCATTCATGCCCAGCCTTATGAC
GTTGCTGAAGCGGTGAAAAAAGTCAATACAGCTGAGGCTGGTGTTAAAATGGACATGGTTAAATCGCAAG
TGTCTGCTGCTCAAAAAGGGATTTCTAGTAATTTAGCAGTTTCTAGTGTGGCCCAAGATACGGCAGATGA
AGCTGAGAAATGGAAAACAGAAATCAATGACAACGACCAGAAGATGTTTTCTGGCGTTTTTTTGGTTATG
GTAAAAGCTGATAGTGCTGAAGAATTGGCAGACTACACAAGTCGCATCAAACAGGCTGGACGCAAACACG
TGATAGAATTTGAGGAAACTTATTATCACCAAGAGGAAGCACTCAATAGTATGCTACCGATTGGAAAGAC
TTATATCGATGTGAAACGTCGCTTTATGCGAGATATGACGACAACCAATATAGCTACCCAAATTCCATTC
ACTAATACAGACTTACAATCTCAAAGTCCACTAGCTAATTACTATGGTCAAAATCAAATCTCTAATAATA
TTATCTCTCTTGACCGACAACGGGATTTATATACGTCTTCAGGTGTTATTCTTGGGTCTTCTGGGTCAGG
GAAGTCTGTTTTTGTTAAAATAAACGAAGTCATTCCAGCTATTTTACGCTTTCCAAACGATCGGGTCATC
ATAGTCGATCCCGAGGAAGAGTACGTGGACATTGGTCATGCCTTTGGTGCTCAGGTTATTGATATCTATC
CAGGAACGAAAACCCATTTTAATCTCATGGATATTCCTGATCTGAATAAGCTCCGAGATGAAGATAAAGA
TTTTGTAGGGCAAAAAGCATCTCTTATCATGGGACTCTTTGAAAATATCCTTCAAGAAGTGACTGACGAT
GATGTGTCACTTATTGATCGTGTCACTCACCTTTGTTATGAACAGATTACCGATCGCACCCCAACCTTAA
AGGATTGGCATGATATTCTCTTGGAACAGCCTGAAGAGGAAGCGCAAAGTCTCGCTTTAAAATCAGAATC
CTATACCAAAGGATCTCAAGATATTTTTGCTTATGAAACGAATGTAGACCTCAATAACCAAGTTGTTATC
TTTAACTTGAAAAAACTATCTGGGAAATTAAAACCCTTTGCCATGATGGTCATTCAGGATTATATTTGGC
AACACGTCGTTGATCACAAAGATGAGTTTGTGACTAGGGTTTACTTTGATGAGATGCAGAATCAATTTGA
AACAGATGACCAGGCAGCTTTCTTTTCTAAAATGTATGCACGTATCCGTAAATACGGGTCAATTCCAACA
GGGATTACGCAGAATGTGGAAACGTTGCTTTCTCGGAAAGAAGGTCGCAACTTACTATATAATAGTGAGT
TCCTCGTGCTCTTAAAACAAAAGAAAACGACCATTCCCTACTTACTAAAAACCATTAATCTAACCGATGC
TCTCGTTCGCTATATTGAAAAGCCAAAAGCGATTGGAACGGGCTTAATTATTGCAGGTACAACAACTGTC
CCATTTGAAAATCCTATTCCTGAGGATACAGAATTATTCCGCTTAGTCGCAACAGATGCTTATCGAAAAA
TGGAGTCGTAG
 Primer design