SecReT4
Protein ID: 25011191
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1140
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1185717..1186469 [-]
Producthypothetical protein
Component typePrgH
UniProt IDQ8E592
KEGG IDsan:gbs1140
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5e-05, Aligned region: 128..237
Protein Sequence: 250 a.a.     [Download]
>gi|25011191|ref|NP_735586.1| hypothetical protein gbs1140 [Streptococcus agalactiae NEM316]
MKDILSELTKGLGSYNSSVNNSMTAVNKSLMAIGYILVSILFLLELLSWYRFIRNQGGEMTWKLFLEVAV
KYFIAYFLVSQSGAILNAILWFTNTVTKLIGVDLSGSNLFEFKALKKGAYGIRTGLNFLAYLIGATAIVS
IKVMVLLRFIELYFYKAIAPVIVAFWMGDDTRHIAKNFLKTFGAIALQSAVIIILLAIWQGFKVDTAMQL
DKNSWLGTYAPAISYIGKCIIFLILLFGSQRKAKQLLQVS
 
Nucleotide Sequence: 753 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1186469-1185717 Streptococcus agalactiae NEM316, complete genome
ATGAAAGATATACTTTCAGAGCTAACCAAGGGACTAGGAAGCTACAATTCTTCAGTAAATAATTCCATGA
CTGCCGTCAATAAGTCTCTCATGGCCATTGGATACATTTTGGTATCCATTTTATTTTTACTTGAGCTGTT
ATCTTGGTATCGCTTTATTCGTAACCAGGGGGGAGAGATGACGTGGAAATTATTCTTAGAAGTGGCTGTT
AAATACTTCATTGCTTATTTCCTAGTTTCCCAATCAGGAGCTATTCTCAATGCCATTTTGTGGTTTACGA
ACACTGTGACCAAACTGATTGGTGTAGATTTAAGTGGAAGTAATTTATTTGAATTTAAAGCTTTGAAAAA
AGGAGCATATGGAATACGAACAGGTCTTAACTTCCTAGCGTATCTAATTGGGGCAACAGCTATTGTGTCT
ATAAAAGTTATGGTACTACTTCGCTTCATTGAACTGTACTTCTATAAAGCCATTGCGCCAGTCATTGTGG
CCTTCTGGATGGGTGATGATACTAGGCATATTGCCAAGAACTTTCTCAAAACCTTCGGAGCCATTGCTCT
TCAAAGCGCAGTAATTATCATTTTATTAGCTATCTGGCAGGGTTTTAAAGTTGATACTGCCATGCAATTA
GATAAAAATAGTTGGCTAGGGACATATGCTCCAGCGATTAGCTACATCGGTAAGTGCATTATCTTTCTGA
TATTGTTGTTTGGTTCTCAGCGCAAAGCTAAGCAGTTATTACAGGTGTCGTAA
 Primer design