SecReT4
Protein ID: 25011193
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1142
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1187109..1187336 [-]
Producthypothetical protein
Component typePrgF
UniProt IDQ8E590
KEGG IDsan:gbs1142
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|25011193|ref|NP_735588.1| hypothetical protein gbs1142 [Streptococcus agalactiae NEM316]
METAVRVVTAMGAILAIVGLGWVLTGAFDYFAGRKNGSPQMMDQGFTSMISGGALAVIAAGVAAAIVAAM
RAISF
 
Nucleotide Sequence: 228 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1187336-1187109 Streptococcus agalactiae NEM316, complete genome
ATGGAAACAGCTGTACGTGTTGTAACCGCTATGGGTGCAATACTTGCGATTGTCGGACTCGGATGGGTCC
TGACAGGCGCTTTTGATTATTTTGCAGGGCGTAAAAACGGAAGTCCTCAGATGATGGATCAGGGGTTTAC
TTCTATGATTTCAGGAGGTGCCTTGGCGGTAATTGCGGCTGGTGTAGCAGCTGCGATTGTAGCTGCTATG
CGAGCTATTTCATTTTAA
 Primer design