SecReT4
Protein ID: 25011194
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1143
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1187611..1190409 [-]
Producthypothetical protein
Component typePrgB
UniProt IDQ8E589
KEGG IDsan:gbs1143
PDB IDNA
Domain hit(s) vs Pfam Gram_pos_anchor [PF00746], Evalue: 5.7e-09, Aligned region: 893..930
Protein Sequence: 932 a.a.     [Download]
>gi|25011194|ref|NP_735589.1| hypothetical protein gbs1143 [Streptococcus agalactiae NEM316]
MNSQETKGHGFFRKSKAYGLVCGIALAGAFTLATSQVSADQVTTQATTQTVTQNQAETVTSTQLDKAVDT
AKKAAVAVTTTTAVNHATTTDAQADLANQTQAVKDVTAKAQANTQAIKDATAENAKIDAENKAEAERVAK
ANKAGQAEVDARNKAGQAAVDARNKAKQQAQDDQKAKIDAENKAESQRVSQLNAQNKAKIDAENKDAQAK
ADATNAQLQKDYQTKLANIKSVEAYNAGVRQRNKDAQAKADATNAQLQKDYQAKLALYNQALKAKAEADK
QSINNVAFDIKAQAKGVDNAEYGNSIMTAKTKPDGSFEFNHDMIDGVKTIGYGKLTGKVNHHYVANKDGS
VTAFVDSVTLYKYEYRNVAQNAAVNQNIVFRVLTKDGRPIFEKAHNGNKTFAETLNKTLQLNLKYELKPH
ASSGNVEVFKIHDDWVHDTHGSALVSYVNNNDAVPNVVIPEQPTPPKPEKVTPEAEKPVPEKPVEPKLVT
PVLKTYTPVKFIPREYKPVPSTPETFTPEKFTPAQPKVKPHVSVPEKINYKVAVHPVQIPKATPTKKVLD
ENGQSINGKSVLPNATLDYVAKQNFSQYKGIKASAEAIAKGFAFVDQPNEALAELTVKSIKASNGDDVSS
LLEMRHVLSKDTLDQKLQSLIKEAGISPVGEFYMWTAKDPQAFYKAYVQKGLDITYNLSFKVKKEFTKGQ
IKNGVAQIDFGNGYTGNIVVNDLTTPEVHKDVLDKEDGKSINNGTVKLGDEVTYKLEGWVVPANRGYDLF
EYKFVDHLQHTHDLYLKDKVVAKVAITLKDGTVIPKGTNLVQYTETVYNKETGRYELAFKADFLAQVSRS
SAFGADDFIVVKRIKAGDVYNTADFFVNGNKVKTETVVTHTPEKPKPVMPQKVTPKAPALPSTGEQGVSV
LTVLGAALLSLLGLVGFKKRQQ
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1190409-1187611 Streptococcus agalactiae NEM316, complete genome
ATGAATTCACAAGAAACAAAAGGTCACGGATTTTTTAGAAAATCAAAAGCATATGGTTTAGTATGTGGGA
TTGCACTAGCAGGTGCATTTACATTAGCTACTAGTCAAGTGTCTGCTGATCAAGTTACAACTCAAGCAAC
AACTCAAACAGTAACGCAAAATCAAGCAGAAACAGTAACATCAACTCAACTTGATAAAGCAGTAGATACA
GCTAAAAAAGCAGCTGTAGCTGTTACAACCACAACAGCAGTTAATCATGCGACAACTACTGATGCACAAG
CTGATTTAGCTAATCAAACACAAGCTGTTAAAGATGTTACTGCAAAAGCACAAGCTAATACACAAGCTAT
TAAAGATGCTACTGCTGAAAATGCAAAAATTGATGCTGAAAACAAAGCAGAGGCAGAGCGTGTTGCAAAA
GCTAATAAAGCAGGTCAAGCAGAAGTAGATGCTCGTAATAAAGCAGGTCAAGCAGCCGTTGATGCACGTA
ATAAAGCAAAACAGCAAGCGCAAGACGATCAAAAAGCAAAAATTGATGCTGAAAACAAAGCAGAGTCTCA
ACGTGTAAGTCAGTTAAATGCACAAAATAAAGCAAAAATTGACGCAGAAAATAAAGATGCGCAAGCTAAA
GCAGATGCGACTAATGCACAATTACAAAAAGACTATCAAACAAAGTTAGCAAACATTAAATCTGTTGAAG
CTTATAATGCAGGTGTACGTCAACGTAATAAAGATGCACAAGCTAAAGCAGATGCGACTAACGCACAGTT
ACAAAAAGACTATCAAGCTAAATTAGCACTTTATAATCAAGCTCTAAAAGCTAAAGCAGAAGCAGATAAA
CAGTCTATTAATAATGTTGCTTTTGACATTAAAGCCCAAGCTAAAGGTGTTGATAACGCTGAATATGGAA
ACTCAATCATGACTGCAAAAACTAAACCTGACGGAAGTTTCGAGTTTAACCACGATATGATCGATGGTGT
GAAGACAATCGGCTATGGTAAGCTTACAGGTAAAGTTAATCATCATTATGTTGCTAACAAGGATGGCTCT
GTGACAGCATTTGTTGATTCTGTCACTCTTTACAAGTACGAGTATCGTAATGTTGCTCAAAATGCTGCTG
TTAACCAAAATATTGTATTTAGAGTTTTAACAAAAGATGGTCGTCCTATTTTTGAAAAAGCTCATAATGG
TAACAAAACTTTTGCAGAAACTTTAAACAAAACTTTACAACTCAATCTTAAATATGAGCTTAAACCACAT
GCTTCCAGCGGTAACGTCGAAGTCTTTAAGATTCATGATGACTGGGTACATGACACACATGGGTCTGCTT
TAGTGTCTTATGTTAATAATAATGATGCTGTTCCTAATGTGGTCATCCCAGAACAGCCAACTCCACCAAA
ACCAGAAAAAGTTACACCTGAAGCAGAAAAACCAGTACCTGAAAAGCCAGTTGAGCCTAAATTGGTAACG
CCTGTTTTAAAAACTTATACTCCAGTCAAATTTATTCCGCGAGAATACAAACCAGTCCCAAGTACCCCTG
AGACGTTTACCCCTGAGAAATTTACTCCAGCTCAACCAAAAGTGAAACCTCATGTGTCTGTACCTGAAAA
AATTAACTATAAAGTAGCGGTGCATCCAGTACAGATACCAAAGGCCACACCAACTAAGAAAGTTCTAGAT
GAAAACGGGCAATCTATTAACGGTAAATCTGTATTACCAAATGCAACATTAGACTATGTTGCTAAACAAA
ACTTTAGTCAATACAAAGGTATTAAAGCTTCTGCAGAAGCTATCGCAAAAGGTTTTGCATTTGTAGATCA
ACCAAATGAAGCGTTAGCTGAATTGACTGTTAAGTCTATCAAAGCATCTAATGGTGATGATGTATCAAGC
TTGTTAGAAATGCGTCATGTTTTATCAAAAGATACTTTAGACCAAAAACTTCAATCTCTTATTAAAGAGG
CAGGAATTAGTCCAGTTGGTGAGTTTTACATGTGGACTGCAAAAGATCCACAAGCTTTTTATAAAGCTTA
TGTTCAAAAAGGTCTAGATATTACTTATAACTTATCATTTAAAGTTAAAAAAGAGTTTACTAAAGGTCAA
ATCAAAAATGGTGTTGCACAGATTGATTTTGGGAATGGATATACAGGTAATATTGTAGTCAATGATTTGA
CAACTCCAGAAGTCCATAAAGACGTGTTAGACAAAGAAGACGGCAAGTCTATTAACAATGGTACTGTCAA
ACTCGGTGACGAAGTCACTTACAAGCTTGAAGGATGGGTTGTACCAGCGAACCGTGGTTACGATCTTTTT
GAATACAAATTTGTAGATCACTTACAACACACACACGATCTTTACCTAAAAGATAAAGTAGTCGCTAAAG
TAGCAATTACACTTAAAGATGGCACTGTAATTCCAAAAGGGACAAATCTAGTTCAATATACTGAGACTGT
CTATAATAAGGAAACAGGTCGCTATGAGTTAGCCTTTAAGGCAGACTTCCTCGCACAAGTTTCACGTTCT
AGTGCCTTTGGGGCAGATGACTTTATTGTAGTTAAACGTATCAAAGCGGGTGATGTTTACAATACCGCAG
ACTTCTTTGTCAATGGCAATAAGGTAAAAACTGAAACTGTGGTAACACATACTCCTGAGAAACCAAAACC
AGTTATGCCGCAAAAAGTAACTCCTAAAGCACCAGCTTTACCATCCACAGGAGAGCAAGGGGTATCTGTC
CTAACAGTACTTGGTGCCGCCTTACTCTCACTCTTAGGCCTTGTAGGGTTTAAAAAGCGTCAACAGTAA
 Primer design