SecReT4
Protein ID: 25011195
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1144
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1190476..1191186 [-]
Producthypothetical protein
Component typePrgC
UniProt IDQ8E588
KEGG IDsan:gbs1144
PDB IDNA
Domain hit(s) vs Pfam Gram_pos_anchor [PF00746], Evalue: 9.7e-05, Aligned region: 197..230
Protein Sequence: 236 a.a.     [Download]
>gi|25011195|ref|NP_735590.1| hypothetical protein gbs1144 [Streptococcus agalactiae NEM316]
MNKRKLLTVLSIASVAVLSSVTFADEITPSDPTAPSTPLITPTPVDPGTPTDTTKPSTPVDPGTPTDTTK
PSTPVDPGTPTDTTKPSTPVDSGTSTNPSDSEATNTNLGTKPTDVVKPETPKIPEVPSTVTPDVIDKVDK
ETGNITIKPIQISPDKTIIGTQNGNVIIRDSSGSHLVSASEVGGRLNEDGTVTIKDSSGKTKTLPRTGEA
KGFLSIIGATILSFVAYLFKQRVTLN
 
Nucleotide Sequence: 711 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1191186-1190476 Streptococcus agalactiae NEM316, complete genome
ATGAATAAAAGAAAATTATTAACAGTCTTATCAATTGCATCAGTTGCAGTTTTATCAAGTGTTACTTTTG
CAGATGAAATAACTCCATCTGATCCAACAGCACCATCAACACCCCTTATTACTCCAACCCCAGTAGATCC
TGGAACACCAACTGATACGACAAAACCTAGTACTCCAGTAGATCCTGGAACGCCAACTGATACGACAAAA
CCTAGTACTCCAGTAGATCCTGGAACACCAACTGATACGACAAAACCTAGTACTCCAGTAGATTCAGGGA
CTTCGACTAATCCCTCAGATTCAGAAGCAACAAATACAAATCTAGGTACAAAACCAACAGATGTAGTTAA
GCCAGAGACACCTAAAATCCCTGAAGTGCCGTCAACAGTAACTCCAGATGTGATTGACAAGGTAGACAAA
GAAACAGGTAATATTACGATTAAACCAATTCAAATCAGCCCTGATAAAACGATTATTGGAACACAAAATG
GTAATGTCATTATTCGAGATAGTTCAGGCAGCCACTTAGTATCTGCAAGTGAAGTTGGTGGTCGACTTAA
TGAAGATGGGACAGTAACAATTAAAGATTCGTCAGGGAAAACAAAAACACTCCCTCGTACTGGAGAAGCT
AAAGGATTCTTAAGCATTATTGGTGCCACAATCCTATCTTTTGTAGCTTATTTATTCAAGCAGAGAGTAA
CTTTAAATTAA
 Primer design