SecReT4
Protein ID: 25011196
T4SS name [ID]Prg/Pcf [675]
Gene symbol-
Locus taggbs1145
StrainStreptococcus agalactiae NEM316
Repliconchromosome [GenBank: NC_004368] [Browse all T4SS(s) in this replicon]
Location [Strand]1191201..1193432 [-]
Producthypothetical protein
Component typePrgA
UniProt IDQ8E587
KEGG IDsan:gbs1145
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 743 a.a.     [Download]
>gi|25011196|ref|NP_735591.1| hypothetical protein gbs1145 [Streptococcus agalactiae NEM316]
MNQIKIITGLTVATLSAVVGNVYAEDITPTAPVNEPQVSSETAKTPQVTESQVNSAKVTADQATSDVNAQ
KNVVNNAQNQKNQAQQKLVNATTTLNETQKLVQESTNQNQVQQTVDSAKQRLSQTEANQKITQTEQVKAQ
NQVNAQQTVVVNNEHDVATKTADVKQAQASVDTAKDALTNTIVNSDLNKAQSNVTTKTADVKTATDALTK
AQATDKTLTNQKAKAQQIVDSAKQNLSAKDTQLSQANAEVNHHKFKTALGQSHYYNQRDNAWAGVYGGHT
FASTGCVPSALAMVYSDLSNRTITPREIADYLYNNTDEFNKRFGGTSGKGIISATKAFGYVVTHLASKNA
ITEALKAGHHVVAAVQNNKFSPWGPQYSHEIVLRGSSNGNTYVYDPYNRDNNGFYSVDRIWNEQSRDSID
TAGVGVPFFAIMTKNMANALTKQSQALASQQVAQKQLNDAQAKATGLNAVTMQTPIAQANLIKAQSNLKD
AQKRLAEAQASVKLANQDNVKKQADLTKAESKLKDAQKQLAAAQAKLTTSKTKLNQLKQVLAEASQQVAQ
ANQDYKQAKDNLTQKTAYLTNLRNAQANLIKAQSDVAQAKDNLANKIAKLQREVAYLQELKTKAVDAQSQ
YQKVLSAYKSVLSAKASLKLAEEKARLDKKGHEAVAVVDETGKITSYITSKHKIEMKSLVATKTTDVKQV
SVAKASVLPSTGDVKQVSVALLGMLLTFSGFLGIRKQSKKVIN
 
Nucleotide Sequence: 2232 bp     [Download]
>gi|25010075|ref|NC_004368.1|:c1193432-1191201 Streptococcus agalactiae NEM316, complete genome
ATGAATCAGATAAAAATTATCACAGGACTTACAGTCGCAACACTATCCGCAGTGGTAGGGAATGTATACG
CAGAAGATATCACACCGACAGCACCAGTTAATGAACCACAAGTATCAAGCGAAACCGCAAAAACGCCTCA
AGTTACAGAAAGTCAAGTTAACAGCGCAAAAGTTACTGCCGATCAAGCAACAAGTGATGTTAATGCACAA
AAAAATGTAGTTAATAATGCTCAAAATCAAAAAAATCAAGCACAACAAAAACTTGTTAACGCAACTACAA
CGTTAAATGAAACACAAAAATTAGTGCAAGAATCTACCAATCAAAATCAAGTACAACAAACAGTTGATTC
CGCAAAGCAAAGGTTGTCGCAGACAGAAGCTAATCAAAAAATTACTCAAACTGAACAAGTCAAAGCTCAA
AATCAAGTTAATGCACAACAAACAGTTGTTGTTAACAATGAGCATGATGTTGCAACTAAGACAGCTGATG
TTAAACAAGCTCAAGCATCAGTCGATACAGCTAAAGATGCTTTGACTAATACTATAGTTAATAGTGATTT
AAATAAAGCACAGTCAAACGTCACAACTAAGACAGCTGATGTTAAAACTGCGACAGATGCACTTACAAAA
GCACAAGCGACTGATAAAACACTTACTAATCAAAAAGCAAAAGCACAACAAATAGTTGATTCAGCAAAAC
AAAACTTATCTGCTAAAGATACACAGCTTTCACAAGCTAATGCTGAGGTCAATCATCACAAGTTTAAAAC
GGCTCTAGGGCAAAGTCATTATTACAATCAACGTGATAATGCTTGGGCTGGGGTATATGGAGGGCATACA
TTTGCTTCAACTGGATGTGTCCCATCAGCATTAGCAATGGTTTACTCTGATTTATCAAATCGGACAATAA
CGCCGAGAGAGATAGCTGATTACTTATACAACAACACAGATGAATTCAATAAACGTTTCGGTGGCACAAG
TGGGAAAGGTATTATTTCTGCTACTAAAGCGTTTGGTTATGTTGTGACTCATTTGGCTAGCAAAAATGCT
ATAACTGAAGCATTAAAAGCAGGTCATCATGTTGTTGCTGCTGTACAAAATAATAAATTCAGTCCCTGGG
GGCCTCAATACAGTCACGAAATTGTATTGAGAGGTAGTTCTAATGGCAATACGTATGTTTATGATCCGTA
TAACCGTGATAACAATGGTTTTTACAGTGTTGACCGCATTTGGAATGAACAGTCACGAGATAGTATTGAT
ACTGCTGGTGTAGGTGTACCGTTTTTCGCAATTATGACTAAAAATATGGCTAATGCTTTAACTAAGCAGT
CACAAGCTTTAGCAAGCCAACAAGTTGCTCAAAAACAATTAAATGATGCACAAGCTAAAGCAACAGGTCT
TAATGCAGTAACTATGCAGACACCGATTGCACAAGCTAATTTGATTAAAGCACAGTCAAATTTAAAAGAT
GCTCAAAAGCGATTAGCAGAAGCACAAGCATCAGTCAAATTAGCTAATCAAGATAATGTTAAAAAACAAG
CTGACTTAACAAAAGCAGAGTCTAAATTAAAAGATGCTCAAAAGCAATTAGCAGCAGCACAAGCTAAATT
GACAACAAGCAAAACAAAACTTAATCAATTAAAACAAGTGTTAGCAGAAGCAAGTCAACAAGTAGCCCAA
GCAAATCAAGATTACAAGCAAGCTAAAGATAATCTAACACAAAAAACTGCTTATCTAACAAATCTACGCA
ATGCACAAGCTAATTTGATTAAAGCACAGTCTGATGTAGCACAAGCTAAAGATAACTTAGCAAATAAGAT
TGCTAAGTTACAAAGAGAAGTAGCTTATTTACAAGAGTTAAAAACTAAAGCAGTAGATGCGCAATCACAG
TATCAAAAAGTTTTATCAGCTTATAAGTCAGTTTTATCAGCTAAAGCAAGTTTAAAATTAGCGGAAGAGA
AAGCTCGACTTGATAAAAAGGGTCACGAAGCAGTAGCAGTAGTTGACGAAACAGGTAAAATTACTAGCTA
TATTACTTCTAAACACAAAATAGAAATGAAATCTCTTGTTGCAACTAAGACAACTGATGTTAAACAAGTA
TCAGTTGCTAAAGCAAGCGTGTTGCCAAGTACTGGTGATGTTAAACAAGTATCAGTTGCTCTTCTGGGTA
TGTTATTAACGTTCTCTGGTTTTTTAGGTATACGTAAACAAAGTAAAAAAGTTATTAATTAA
 Primer design