SecReT4
Protein ID: 251788073
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0428
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]495098..496621 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDC6CI69
KEGG IDdze:Dd1591_0428
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.6e-125, Aligned region: 10..492
Protein Sequence: 507 a.a.     [Download]
>gi|251788073|ref|YP_003002794.1| hypothetical protein Dd1591_0428 [Dickeya zeae Ech1591]
MTLFTTDYLEYYLTLVSWIVHNGIWAVLVSSGVFVLPFVAIIIDEWLRARTEGADEGNKGVLSSMRIENR
VWVAIVVVMFAGIPFIDVDLNTIRYDQARSAQCRISVPQPEDTGWSKSFSTLNNQSAKVPVWWAFMHALS
RAITSASVSAIPCGTDLRQMRMEINATRIDDPVLAQEIADFTHDCYGPARAKLFMTRPNLDKTQMHDVTW
IGSTYFVSTAGFYDTYHARTPREGWAYDSHRDAGLAQVPSGAGYPSCRQWWSDGGNGLRARLLAQVDPSL
LNRIAGWAGFLSRTEVDDSVIRTIASPHQQKLNQGSVYTDYGGQIDKTLPNIVTRAAGDIGMTVGGLAAF
PALDVMRQGLPMVLALLKMALVICIPLVLLVGTYNLKTTITVSVVQFALFFADFWFQLARWIDSTILDAL
YGWGWGWNRPHGNVDPMAGLSNTFGDMLLNFVMGTMFIVLPTFWIMALAWAGVRAGNVLQGFAGATADAK
AAGAKGGDMVLKSVSKK
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c496621-495098 Dickeya zeae Ech1591 chromosome, complete genome
ATGACGCTTTTCACCACCGATTACCTGGAGTATTACCTGACTCTGGTGAGCTGGATCGTCCACAACGGTA
TTTGGGCGGTATTGGTTTCCAGCGGCGTGTTTGTCCTCCCCTTCGTGGCCATCATCATCGACGAGTGGCT
GAGAGCCCGTACCGAAGGCGCTGATGAGGGCAACAAGGGCGTGCTGTCATCAATGCGCATTGAGAACCGG
GTATGGGTGGCAATTGTTGTGGTGATGTTCGCAGGCATTCCGTTCATCGATGTCGACCTCAACACGATCA
GATACGACCAGGCGCGTTCGGCACAGTGCCGGATCAGCGTACCGCAGCCCGAAGACACTGGCTGGTCAAA
ATCCTTCAGCACCCTCAACAACCAGAGCGCCAAAGTGCCAGTCTGGTGGGCCTTCATGCATGCACTCTCA
CGTGCGATCACCAGTGCCTCGGTATCAGCTATCCCATGCGGCACCGACCTGCGGCAAATGAGAATGGAGA
TCAATGCTACCCGTATTGATGACCCAGTACTGGCTCAGGAAATAGCAGACTTTACCCACGATTGCTACGG
CCCCGCACGCGCCAAGCTGTTCATGACTCGTCCCAATCTTGACAAGACACAAATGCACGATGTGACCTGG
ATCGGCTCGACCTATTTTGTCAGTACAGCAGGCTTCTACGACACCTATCACGCCAGGACACCGCGTGAGG
GTTGGGCCTACGACAGCCATCGTGACGCCGGACTGGCTCAGGTGCCAAGTGGTGCTGGCTACCCGAGTTG
CCGCCAGTGGTGGAGCGATGGAGGAAACGGCTTGCGTGCACGTCTGTTGGCACAGGTCGATCCCAGCTTA
CTCAATCGCATCGCCGGCTGGGCCGGGTTCCTCAGCCGCACGGAGGTAGATGACTCGGTTATCAGGACGA
TTGCCTCCCCTCACCAACAGAAACTCAACCAAGGTAGTGTCTACACGGATTACGGCGGTCAAATCGATAA
AACCTTACCGAATATCGTTACTCGCGCTGCGGGTGACATCGGCATGACAGTGGGAGGACTCGCCGCATTC
CCGGCATTGGACGTGATGCGCCAGGGACTGCCGATGGTGCTTGCATTACTGAAGATGGCGCTGGTGATCT
GTATCCCTCTTGTACTTCTGGTAGGCACTTACAACCTGAAGACAACGATAACGGTCAGCGTCGTGCAGTT
TGCGCTGTTCTTTGCAGATTTTTGGTTTCAACTGGCACGATGGATTGACAGCACCATCCTCGATGCACTT
TACGGGTGGGGTTGGGGCTGGAATCGGCCGCACGGCAACGTCGATCCGATGGCAGGTTTGAGTAACACTT
TCGGCGACATGCTGCTGAACTTCGTCATGGGCACGATGTTCATTGTATTACCCACATTCTGGATAATGGC
TTTGGCTTGGGCAGGCGTCCGCGCCGGTAATGTTCTTCAAGGGTTCGCTGGAGCTACAGCTGATGCCAAA
GCAGCAGGAGCAAAAGGAGGTGACATGGTTCTTAAATCCGTATCGAAAAAATAA
 Primer design