SecReT4
Protein ID: 251788075
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0430
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]496980..498380 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDC6CI71
KEGG IDdze:Dd1591_0430
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 466 a.a.     [Download]
>gi|251788075|ref|YP_003002796.1| hypothetical protein Dd1591_0430 [Dickeya zeae Ech1591]
MMKHLNPNAFSTPTLHLWQCALLVTALSMTSGLALAQDGGFQNSGAVIGDEVMYSIGGGNAISMSSAASM
RSIGVGVGWNSNLICGDMNISTTIQNQLNGLTNGFQNIMSSVIQNATSAVASLPALIIQRADPGLYNLLT
NGILQARLDFDRSKLTCRAMAERMADTAGGQLGWSQIAEGMALRQAVSSTDAVSAIEQAEKNRGNDGVPW
VGGDNAGGVGQHSIKVIGDVTRAGYNLVNGRNVADTSSIDTASCQSLSCQTWASPQQAIDFATRVLGEQE
QRTCEGCIRTETVPGVGLTPVIQEEYDTKLKVLQELVRGTRNTTFENLHDAGSTSLPITRGVIEALRDEP
DQDILARRLASEVALASVLEKALLLQRTLLTGQKEPNVAANRLAVAAVTQESNTLDREILNLKTELELRR
ELASNSPMAIIQRHSVRSAGSRGIYEGDPVPNRLDQLQRRNPGGTP
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c498380-496980 Dickeya zeae Ech1591 chromosome, complete genome
ATGATGAAACATCTCAATCCGAACGCATTCTCAACGCCTACGCTACACCTGTGGCAATGCGCGCTATTGG
TTACCGCACTGTCTATGACCAGTGGCCTGGCTCTGGCACAGGATGGAGGCTTCCAGAACAGCGGTGCTGT
CATTGGCGATGAGGTGATGTACTCCATCGGTGGCGGCAACGCCATATCGATGAGTAGTGCGGCCAGTATG
CGCTCGATTGGTGTCGGTGTGGGCTGGAACAGCAATCTGATCTGCGGCGACATGAACATCAGTACGACCA
TCCAGAATCAGCTCAATGGGCTAACCAACGGCTTCCAGAACATCATGAGCAGCGTGATCCAGAACGCCAC
CAGCGCGGTCGCCTCATTGCCTGCACTCATCATCCAGCGGGCCGATCCGGGTCTCTACAACCTGCTGACC
AATGGTATTCTGCAAGCTCGGCTCGACTTTGATCGCTCCAAACTCACCTGCCGGGCGATGGCGGAACGCA
TGGCAGACACGGCAGGCGGCCAACTCGGCTGGAGCCAGATTGCCGAAGGCATGGCGCTGCGTCAGGCGGT
ATCCAGCACCGATGCCGTATCGGCTATTGAACAAGCTGAAAAAAACCGAGGCAATGACGGGGTGCCGTGG
GTCGGCGGCGATAACGCCGGCGGTGTCGGACAACACTCAATCAAGGTCATCGGAGACGTAACCCGTGCAG
GTTACAACCTGGTCAACGGCCGCAATGTGGCCGACACGTCATCCATCGACACCGCGAGTTGCCAAAGCCT
GTCCTGCCAGACCTGGGCATCACCACAACAGGCTATTGACTTTGCCACTCGTGTGCTGGGCGAACAGGAG
CAGCGTACCTGCGAAGGCTGTATCAGGACCGAGACCGTACCCGGCGTCGGTCTGACCCCGGTCATCCAGG
AAGAGTACGACACCAAGCTGAAAGTGCTGCAGGAATTGGTCAGAGGAACCCGCAATACCACGTTTGAGAA
CCTTCACGACGCTGGCAGTACTTCGCTGCCAATCACCCGTGGCGTTATCGAGGCACTGCGTGACGAACCT
GATCAAGACATTCTGGCCCGACGCCTGGCCTCCGAAGTTGCGCTGGCATCGGTATTGGAAAAAGCCCTGC
TGCTGCAGCGCACGCTACTGACTGGCCAGAAAGAGCCGAATGTTGCGGCGAATCGGTTGGCAGTCGCTGC
CGTCACTCAGGAAAGCAACACCCTCGACCGCGAGATCCTCAACCTCAAAACCGAGCTTGAGCTACGCCGG
GAACTCGCCAGCAACTCACCGATGGCCATTATCCAACGCCACAGTGTACGTTCAGCCGGTTCACGCGGTA
TCTATGAAGGAGACCCTGTACCTAACCGTCTCGACCAGTTACAGCGACGCAATCCCGGAGGCACACCATG
A
 Primer design