SecReT4
Protein ID: 251788076
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0431
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]498388..499314 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDC6CI72
KEGG IDdze:Dd1591_0431
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.2e-95, Aligned region: 27..296
Protein Sequence: 308 a.a.     [Download]
>gi|251788076|ref|YP_003002797.1| hypothetical protein Dd1591_0431 [Dickeya zeae Ech1591]
MRLPRCLHASILLTAASSSFALNTVAIISSSLSPDCLEYRVTGICYWLLCTPFGCSVRTSVKVRHYVPDA
VVSSYGNTGKNPWIEVRAMSMPNTTAQDGGDGTSNHSNEDNLSRFRNADVIGHPGGQAFSQFASSSGYIC
DGAGIAFMPYLLSTLDTVAWRYNIPEVVYPEALIPGMREIGARATLNLWGSLYPRGGFLHQVDSYKASAV
VAQRAGDIVTRRGQLHVYQPLLANAHDGYWPAGALMENDASTGKWQELAPDLSSSCTVFPHNGPLTQAQQ
DDYAWALWRPYSCCQRRGQTFLGSMDFN
 
Nucleotide Sequence: 927 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c499314-498388 Dickeya zeae Ech1591 chromosome, complete genome
ATGAGACTCCCACGCTGTCTGCACGCCAGCATTTTGCTGACCGCAGCCAGTTCATCGTTCGCTCTCAACA
CCGTCGCCATCATATCCTCGTCGTTATCCCCTGATTGCCTGGAATACCGCGTCACCGGGATCTGCTACTG
GCTGCTTTGCACCCCGTTCGGATGTTCGGTACGCACTTCCGTCAAAGTCAGGCACTACGTTCCCGATGCC
GTGGTATCGAGCTATGGCAATACGGGCAAAAACCCGTGGATTGAGGTGCGCGCCATGAGCATGCCCAACA
CCACGGCCCAGGACGGCGGTGACGGCACCAGCAACCATAGCAACGAGGACAATCTATCCAGATTCCGCAA
CGCTGACGTGATCGGCCACCCCGGTGGCCAGGCATTCAGTCAGTTTGCCTCGTCATCAGGCTACATCTGC
GACGGTGCCGGCATTGCGTTCATGCCGTACCTGCTGAGCACACTGGATACCGTCGCGTGGCGCTACAACA
TTCCCGAAGTCGTGTATCCCGAGGCGCTGATCCCCGGTATGCGCGAGATCGGCGCACGCGCCACGCTGAA
CCTGTGGGGCAGCCTCTATCCGCGCGGTGGTTTCCTGCACCAGGTGGACAGCTACAAGGCCAGTGCCGTG
GTCGCCCAACGGGCGGGCGACATCGTGACCCGTCGGGGACAACTGCATGTATACCAACCCTTGCTTGCCA
ACGCGCACGACGGTTACTGGCCAGCAGGCGCACTGATGGAAAACGATGCATCGACCGGCAAATGGCAAGA
GCTGGCCCCTGACCTGTCCTCCTCCTGCACAGTCTTCCCACATAACGGGCCACTGACTCAGGCGCAGCAA
GACGACTATGCCTGGGCACTATGGCGACCGTATAGCTGCTGCCAGCGACGCGGCCAGACCTTTCTCGGCA
GTATGGATTTCAACTGA
 Primer design