SecReT4
Protein ID: 251788077
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0432
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]499311..499769 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDC6CI73
KEGG IDdze:Dd1591_0432
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.5e-35, Aligned region: 39..149
Protein Sequence: 152 a.a.     [Download]
>gi|251788077|ref|YP_003002798.1| hypothetical protein Dd1591_0432 [Dickeya zeae Ech1591]
MINFAVLHMLASASIYSFSLHRLATVLLTALLSPLVQAADLLAVTDTRHPMQNLGNTRLIELDRPSRIEA
ELAANLPKDPTYATAIVQQRLKEGGTALQQRINEAYQNVVDAWSLGITTLPAVIVDQRYVVYGEPDVAKA
VARIEAYTRTQQ
 
Nucleotide Sequence: 459 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c499769-499311 Dickeya zeae Ech1591 chromosome, complete genome
ATGATCAATTTTGCGGTACTCCATATGCTGGCTTCTGCTTCCATCTATTCCTTTTCGCTGCATAGGCTTG
CTACTGTCTTGCTCACTGCGCTGCTGAGTCCACTCGTACAGGCTGCGGATCTACTGGCCGTTACTGACAC
CCGGCACCCGATGCAAAACCTGGGCAACACCCGGCTCATCGAACTGGACCGCCCATCACGCATCGAAGCC
GAGCTGGCAGCCAACCTCCCCAAAGATCCAACCTACGCCACTGCAATCGTGCAACAACGCCTGAAAGAAG
GCGGCACCGCCCTGCAGCAGCGCATCAACGAGGCCTATCAGAACGTTGTCGATGCCTGGAGCCTGGGCAT
CACCACCCTTCCCGCCGTTATCGTTGATCAACGGTATGTGGTTTACGGAGAGCCTGACGTCGCCAAAGCG
GTTGCGCGTATCGAAGCTTACACGAGGACTCAGCAATGA
 Primer design