SecReT4
Protein ID: 251788080
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0435
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]501545..504394 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDC6CI76
KEGG IDdze:Dd1591_0435
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.1e-68, Aligned region: 60..334
AAA_10 [PF12846], Evalue: 9.5e-46, Aligned region: 527..864
Protein Sequence: 949 a.a.     [Download]
>gi|251788080|ref|YP_003002801.1| hypothetical protein Dd1591_0435 [Dickeya zeae Ech1591]
MVWSLLRRKSAEVIKDALPDGWQHHVNTLQQAGIPEPGSTTRGNSPATQADEQALYQVVPSLVELLPWVE
YLPTSQSMLLEDGSSVAAFFELTPLGTEGREPSWLAQARDALENALQDSFDEFDDNPWVLQLYAQDETNF
DAYLQTLHRYIRPRAQGSRFTEFYLHSMAHHLHAVAKPGGLFDDTTVTRLPWRGQMRRVRMVVYRRTTGG
TARRGQTPEQGLNVVCDRLTGGLTNAGIRAHRLDAAQIHDWLLRWFNPHPTLLGLGAEDRERFYQLTAYP
NTCDADEIELASGRDFSQRLFFSQPRSNADQGVWYFDDIPHRAVVTDRLRTPPDVGHLTGENHKGDAINT
LFDQMPEDTVMCLTLVATPQDVLETHLNHLAKKAVGETLASEQTLADVQEARSLIGSSHKLYRASLAFYL
RGRNEEELDSKGLQLANVMLGAGLQPVREEDEVAPLNTYLRWLPCMYNPAQDRKQWYTQLMFAQHVANLS
PTWGRSRGTGHPGITVFNRGGGLITFDPFNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPRIF
IVEAGNSFGLFCEFARRLGLTVNRVKLAPGAGVSLAPFADARRLIETPSDVQTLDADELDDERQSKGTEA
DEQRDVLGELEITARLIITGGEDKEEARMTRADRSLIRQCILDAAQRGVTANRTVLTRDVRDALRERGHD
TTLPEIRRARLLEMADAMDMFCQGSDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLINTV
NNIAERDQFLGRPILNVTDEGHIITKNPLLSPYVVKVTKMWRKLGAWFWLATQNIDDLPKAAEPMLNMIE
WWICLSMPPDEVEKIARFRELTPAQKALMLSARKESGKFTEGVILSKNLEVLFRAVPPSLYLALAQTEPE
EKAERYRLMQQCGISELDAAFKVAEMIDHARGITPMVQR
 
Nucleotide Sequence: 2850 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c504394-501545 Dickeya zeae Ech1591 chromosome, complete genome
ATGGTCTGGTCGCTTCTCCGTCGTAAATCCGCCGAGGTCATCAAAGACGCACTGCCGGACGGCTGGCAGC
ACCACGTCAACACACTGCAACAGGCGGGTATTCCTGAACCCGGATCCACCACCAGGGGAAACAGCCCCGC
TACACAAGCCGACGAACAAGCCTTGTACCAGGTTGTACCATCGCTGGTCGAGCTACTGCCCTGGGTTGAA
TACCTGCCCACATCACAAAGCATGCTGCTGGAGGATGGCAGCTCGGTCGCCGCATTCTTCGAACTGACCC
CATTGGGTACCGAAGGCCGTGAACCGTCCTGGCTGGCACAGGCACGGGATGCACTGGAGAACGCGCTGCA
GGACAGTTTTGATGAGTTTGACGACAACCCCTGGGTGCTGCAGCTCTATGCCCAGGACGAGACAAACTTT
GACGCCTATCTGCAGACCTTGCATCGCTACATTCGACCACGCGCACAAGGCTCGCGTTTCACTGAATTCT
ACCTGCATTCGATGGCTCATCACCTGCACGCGGTAGCAAAGCCGGGCGGCCTGTTCGATGACACCACAGT
CACCCGGCTGCCCTGGCGTGGCCAAATGCGCCGGGTACGCATGGTGGTCTATCGCCGTACTACAGGCGGC
ACAGCACGACGCGGCCAGACGCCCGAGCAGGGATTGAACGTGGTTTGTGATCGCCTGACCGGAGGCCTGA
CCAACGCTGGCATTCGTGCACATCGGCTGGATGCCGCACAAATTCACGACTGGCTGCTACGCTGGTTCAA
CCCACATCCCACGCTACTGGGACTGGGTGCCGAAGACCGCGAACGCTTCTACCAGTTGACAGCCTACCCG
AATACCTGTGACGCCGACGAGATCGAGCTGGCCTCCGGACGCGATTTCAGTCAGCGACTGTTCTTCAGCC
AGCCACGCTCAAATGCAGATCAGGGTGTGTGGTACTTCGACGACATCCCGCATCGGGCAGTCGTGACCGA
CCGCCTGCGTACCCCACCAGATGTAGGGCATCTGACAGGTGAAAACCACAAGGGTGATGCCATCAATACC
CTGTTCGACCAGATGCCGGAAGACACTGTGATGTGCCTGACGCTGGTTGCCACACCACAGGACGTGCTCG
AAACGCACCTGAATCATCTGGCCAAAAAAGCCGTGGGCGAGACGCTGGCATCCGAACAAACCCTGGCGGA
CGTGCAAGAGGCTCGATCGCTGATCGGCAGTTCCCACAAGCTGTACCGCGCCAGCCTGGCGTTTTACCTG
CGTGGGCGGAATGAAGAAGAGCTCGACAGCAAGGGGCTGCAACTGGCCAACGTGATGCTGGGCGCAGGCC
TTCAGCCAGTACGCGAAGAGGACGAAGTCGCCCCGCTCAACACGTATCTGCGCTGGCTACCGTGTATGTA
CAACCCGGCCCAAGACCGCAAGCAGTGGTACACGCAATTGATGTTCGCCCAGCATGTGGCCAACCTCTCA
CCAACCTGGGGGCGTAGCCGGGGTACGGGCCATCCAGGGATCACTGTCTTCAATCGCGGAGGAGGCCTGA
TCACGTTCGACCCATTCAACCGCCTGGATCGGCAGATGAACGCGCACCTTTTCCTGTTCGGCCCCACAGG
CTCAGGCAAAAGCGCAACCCTCAACAACCTGCTCAATCAAGTCACCGCAATCTATCGTCCACGGATTTTC
ATTGTGGAGGCAGGCAATTCCTTCGGGCTGTTCTGCGAGTTCGCCCGGCGTTTAGGACTGACCGTCAACC
GAGTCAAACTCGCCCCCGGAGCCGGTGTAAGTCTCGCGCCGTTCGCCGACGCCCGTCGACTCATTGAAAC
GCCCAGTGACGTACAAACACTCGATGCCGATGAACTGGATGATGAACGACAGAGCAAGGGAACTGAGGCT
GATGAACAGCGCGATGTGCTGGGAGAACTGGAAATCACCGCACGTTTGATAATCACCGGTGGTGAAGACA
AGGAAGAAGCCCGCATGACCCGGGCCGATCGCTCGTTGATCCGCCAGTGCATTCTGGACGCAGCCCAACG
CGGCGTGACGGCCAACCGCACCGTACTGACCCGCGACGTACGTGATGCGCTGCGTGAGCGCGGCCATGAC
ACCACACTGCCGGAAATCCGGCGTGCTCGCCTGCTGGAGATGGCAGACGCAATGGATATGTTCTGCCAGG
GCAGCGACGGAGAAATGTTCGACCGCGATGGCACCCCCTGGCCAGAGGCCGACATCACCCTAGTCGACCT
GGCAACCTATGCGCGTGAAGGTTATAACGCACAACTGTCGATCGCCTACATCTCACTCATCAACACCGTC
AACAACATCGCCGAGCGCGACCAGTTCCTGGGCCGACCCATCCTCAACGTGACGGATGAAGGCCATATCA
TCACCAAAAACCCCTTGCTCTCGCCCTACGTTGTGAAAGTAACAAAAATGTGGCGCAAGCTTGGGGCATG
GTTCTGGCTCGCGACGCAGAACATCGACGATCTGCCAAAAGCGGCAGAACCGATGCTCAACATGATCGAG
TGGTGGATTTGCCTGTCGATGCCGCCCGACGAAGTCGAGAAAATTGCCCGGTTCAGGGAACTGACACCCG
CTCAGAAGGCGCTGATGCTGTCAGCACGGAAAGAATCCGGCAAATTCACCGAAGGCGTCATCCTCTCCAA
GAACCTGGAGGTGCTATTCCGTGCTGTCCCCCCCAGTCTCTACCTCGCCCTGGCGCAGACCGAGCCCGAG
GAAAAAGCCGAACGCTACCGGCTGATGCAACAGTGCGGCATTAGCGAGTTGGATGCCGCGTTCAAAGTAG
CCGAAATGATTGACCATGCACGTGGCATCACGCCCATGGTACAGAGGTGA
 Primer design