SecReT4
Protein ID: 251788081
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0436
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]504394..504831 [-]
Productputative secreted protein
Component typeTfc15
UniProt IDC6CI77
KEGG IDdze:Dd1591_0436
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 145 a.a.     [Download]
>gi|251788081|ref|YP_003002802.1| putative secreted protein [Dickeya zeae Ech1591]
MHSNWTKSLAIMVTVTVLTSCATSKEELLPHGGRTMQDIWQQESGNGGSPGQMAYRQLLDARQSLRRPLS
HADVKTVSTEQESYTRTAANDVRSQFQRLPNPDLLMYVFPHLAGTDPVPVPGYTTIFPLYQRVQYAMPGE
RTEDY
 
Nucleotide Sequence: 438 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c504831-504394 Dickeya zeae Ech1591 chromosome, complete genome
ATGCATTCGAACTGGACTAAATCGTTGGCAATCATGGTAACGGTAACCGTATTGACCAGTTGCGCTACCA
GCAAGGAAGAGCTGTTGCCCCATGGCGGTCGAACCATGCAGGACATCTGGCAGCAGGAGAGCGGCAATGG
AGGCAGTCCGGGTCAGATGGCATACCGTCAACTGCTCGATGCCCGTCAGAGCTTACGTCGCCCACTCAGC
CATGCAGATGTGAAAACAGTTTCCACTGAGCAGGAAAGCTACACGCGTACCGCCGCCAATGATGTACGCA
GCCAGTTTCAACGGCTGCCCAATCCCGACTTGTTGATGTACGTGTTCCCGCATCTGGCGGGGACAGACCC
GGTTCCGGTGCCGGGTTACACCACCATTTTCCCGCTCTATCAGCGTGTACAGTACGCGATGCCAGGGGAA
CGTACGGAGGACTACTGA
 Primer design