SecReT4
Protein ID: 251788082
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0437
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]504812..506212 [-]
Productputative secreted protein
Component typeTfc14
UniProt IDC6CI78
KEGG IDdze:Dd1591_0437
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 466 a.a.     [Download]
>gi|251788082|ref|YP_003002803.1| putative secreted protein [Dickeya zeae Ech1591]
MPSNGLLKWLMIPVILLVLFVGIRIFSGHGTHTPDTADTGSQLTPEEMKALGIEGDTPRDTVATLVAQVR
QLRSELQTATADNRTQHEENQRLRQRESTIDQRINTALESERANLRRDQEQFSSERQQTEGLLADLQRRL
DSIGSNGHADLPVGLGLRDGDAEGFGNEAAIRWVEPDDARQTAGRNSNTARSFPTSFGPAQKTLDTTVES
VTRASATGTKPARAVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAG
AVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPQDSEHSHQQSNDQNSLGWISDPYGIPCVSGERRS
NAQQYLGTQALITAAGAGAASLMDSKSSQMSYTGANGSIGTVGISSNEAVGRILAGGVRDMSDWVNKLYG
QAFAAVYVKPGAQVAVHLEKPLAIDYETEGRKVDHRTGESHAFELD
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c506212-504812 Dickeya zeae Ech1591 chromosome, complete genome
ATGCCCAGTAACGGTCTACTGAAATGGTTGATGATCCCGGTGATCTTGCTGGTGCTGTTCGTTGGCATCC
GCATATTCTCTGGTCATGGCACGCATACACCAGACACAGCCGATACAGGTAGCCAGCTCACCCCGGAGGA
AATGAAGGCGTTGGGTATCGAAGGGGACACACCACGTGACACCGTCGCCACACTGGTAGCACAGGTCCGG
CAACTGCGCTCCGAACTGCAAACCGCGACTGCCGACAACCGGACACAGCACGAAGAAAACCAGCGTCTGC
GCCAGCGTGAAAGCACCATTGACCAGCGTATCAACACCGCACTGGAGTCCGAGCGAGCTAACCTGCGCCG
CGACCAGGAACAGTTCAGTAGTGAACGTCAGCAGACTGAAGGTCTGCTGGCAGATTTGCAGCGACGGCTG
GATAGCATAGGCAGCAATGGTCACGCAGACTTGCCTGTCGGTCTTGGTCTGCGAGACGGGGATGCTGAAG
GGTTCGGCAACGAGGCCGCTATCCGCTGGGTAGAGCCTGACGATGCCAGGCAGACTGCAGGCCGCAATAG
CAACACGGCGCGGAGCTTCCCGACAAGTTTCGGACCTGCGCAGAAGACACTGGACACTACGGTCGAAAGT
GTAACCCGTGCCAGCGCTACCGGAACCAAACCCGCCAGGGCTGTTTACACCGTACCCACCAATTCAACAC
TGATGGGCTCAGTCGCGATGACTGCGCTGATCGGCCGTGTGCCTATCGACGGTACCGTCAACGACCCCTA
CCCCTTCAAAGTGTTGGTTGGCCCCGACAACCTGACGGCCAACGGCATCGATATCCCCGATGTGGCCGGA
GCCGTGTTCAGCGGCACCGCCTCCGGCGACTGGACGCTCTCATGCGTCAGGGGGCAGGTACGCTCAATCA
CCTTCGTTTTCCACGACGGCACCATCCGCACCATTCCGCAAGATAGCGAACACAGTCATCAGCAAAGCAA
CGACCAGAACAGTCTCGGATGGATCAGTGATCCCTACGGTATCCCGTGCGTGTCCGGAGAGCGCCGCAGC
AATGCCCAGCAGTATCTCGGCACGCAGGCTTTGATCACCGCAGCGGGTGCAGGCGCGGCATCGCTCATGG
ATTCAAAAAGCAGCCAGATGTCCTACACCGGTGCCAACGGTTCCATCGGCACGGTGGGGATCAGCAGCAA
CGAGGCGGTGGGGCGCATTCTTGCCGGCGGCGTACGCGACATGTCGGATTGGGTCAACAAGCTCTATGGC
CAGGCCTTCGCAGCGGTCTATGTGAAGCCAGGCGCACAAGTTGCCGTTCACCTCGAAAAACCTCTCGCCA
TTGACTACGAAACCGAAGGCCGCAAGGTCGACCATCGTACAGGAGAAAGCCATGCATTCGAACTGGACTA
A
 Primer design