SecReT4
Protein ID: 251788083
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0438
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]506202..507095 [-]
Productputative signal peptide
Component typeTfc13
UniProt IDC6CI79
KEGG IDdze:Dd1591_0438
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.1e-121, Aligned region: 7..281
Protein Sequence: 297 a.a.     [Download]
>gi|251788083|ref|YP_003002804.1| putative signal peptide [Dickeya zeae Ech1591]
MKFRLIRLGLLTLVMASSAHAVEILRWERLPLAVPLTVGQERIVFVEHNVRVGIPASIGDRLRVQSAGGA
IYLRASKPIEPTRLQLQDVDSGALILLDIDAMPAKEGEPKLEPVRIVEDNTTPPHYAQQLDSATKTPITE
PDRPTQHETPVAVVLTRYAAQNLYAPLRTVEPVPGIMRVNLRHNLPFDTLLPTLPVQATALVSWRLEDQW
VTAVRLTHTEGGWIRLDPRTLQGDFLAATFQHAALGPHGTPEDTTVLYLVTRKHGLSQSLLPAIQRVDPA
VHLPTSTPPTTEVNHAQ
 
Nucleotide Sequence: 894 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c507095-506202 Dickeya zeae Ech1591 chromosome, complete genome
ATGAAATTCCGTCTCATCCGGCTGGGGCTTCTGACTCTGGTAATGGCATCATCTGCCCATGCAGTAGAGA
TCCTGCGTTGGGAGCGACTGCCTCTTGCCGTACCGCTGACTGTCGGACAGGAACGTATTGTATTCGTGGA
ACACAACGTCCGTGTCGGCATCCCGGCCAGCATCGGCGACCGCCTGCGTGTGCAGAGTGCCGGTGGTGCC
ATCTATCTGCGTGCCAGCAAGCCCATCGAACCCACCCGATTACAGTTGCAGGACGTAGACAGTGGTGCGT
TGATCCTACTCGACATTGATGCCATGCCAGCCAAAGAGGGCGAACCGAAACTTGAGCCTGTGCGCATCGT
CGAGGACAATACCACGCCACCGCACTATGCCCAGCAACTGGACAGCGCAACCAAAACGCCCATTACAGAA
CCGGACAGGCCGACGCAACATGAAACGCCGGTAGCCGTGGTACTGACACGCTACGCCGCACAGAACCTGT
ACGCACCACTGCGCACTGTTGAACCCGTGCCCGGCATCATGCGGGTAAATTTGCGCCATAATCTGCCATT
CGACACCTTACTGCCTACGCTGCCGGTTCAGGCGACAGCGCTGGTTTCATGGCGATTGGAAGATCAGTGG
GTCACGGCCGTGCGACTGACCCATACAGAGGGTGGTTGGATTCGGTTAGATCCACGCACACTGCAAGGTG
ATTTCCTCGCGGCTACTTTTCAGCATGCGGCGCTCGGCCCACACGGTACCCCCGAAGACACCACAGTACT
GTATCTGGTTACCCGCAAGCATGGACTGTCCCAGTCGCTACTGCCCGCCATCCAACGCGTTGATCCTGCC
GTACACTTGCCTACTTCGACGCCCCCGACAACGGAGGTGAATCATGCCCAGTAA
 Primer design