SecReT4
Protein ID: 251788084
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0439
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]507092..507772 [-]
Productputative secreted protein
Component typeTfc12
UniProt IDC6CI80
KEGG IDdze:Dd1591_0439
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.5e-85, Aligned region: 6..206
Protein Sequence: 226 a.a.     [Download]
>gi|251788084|ref|YP_003002805.1| putative secreted protein [Dickeya zeae Ech1591]
MSRFKNEVIHLQAHIKTLRIGASALLLVALVMGVGWWSAPRDLTIHIPPDLRSGSSRAWWEVPPESVYAF
TFYVFQQLNRWPTNGEEDYARNLHALSPYFTPACLAFLQADYDYRRSTGELQQRVRGVYEIPGRGYGDNP
AARVRVVSDRDWVVTLDLSADEYHGPEQVKRALVRYPLKVARVDVDPVRNPFGLVLDCYDGVPQHISPPT
QETPNRVGMGKQGETP
 
Nucleotide Sequence: 681 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c507772-507092 Dickeya zeae Ech1591 chromosome, complete genome
ATGAGCCGATTCAAAAACGAAGTCATACATCTACAGGCTCACATCAAGACCCTTCGCATCGGTGCCAGCG
CATTACTCCTTGTCGCACTGGTGATGGGGGTGGGTTGGTGGAGCGCACCGCGTGATCTGACGATCCACAT
ACCACCCGATCTGCGTTCAGGGAGTTCACGCGCCTGGTGGGAGGTCCCTCCTGAATCGGTCTACGCCTTC
ACATTCTATGTGTTCCAGCAGCTCAACCGCTGGCCAACCAATGGAGAAGAGGACTACGCACGTAACCTCC
ATGCATTATCGCCGTACTTCACTCCGGCATGCCTCGCCTTTCTGCAGGCGGATTACGACTATCGCCGCAG
CACAGGCGAACTGCAACAACGTGTACGCGGCGTCTACGAAATCCCCGGTCGCGGCTATGGCGATAATCCT
GCCGCACGGGTACGCGTGGTCTCTGACCGCGATTGGGTCGTCACGCTCGATCTCAGCGCCGACGAGTACC
ACGGCCCGGAACAGGTCAAGCGCGCTCTGGTGCGCTACCCGCTCAAAGTCGCGCGCGTAGATGTCGATCC
GGTCCGTAATCCGTTTGGTCTGGTGCTCGACTGCTACGACGGTGTTCCGCAGCACATCTCCCCCCCGACG
CAGGAAACACCCAATCGTGTCGGCATGGGCAAGCAAGGAGAAACCCCATGA
 Primer design