SecReT4
Protein ID: 251788085
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0440
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]507769..508167 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDC6CI81
KEGG IDdze:Dd1591_0440
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 9.2e-46, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|251788085|ref|YP_003002806.1| hypothetical protein Dd1591_0440 [Dickeya zeae Ech1591]
MSAYPHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLFGCAGLLIGVPLSWLLSTIALAPTCIVLG
ITCGVFVGGGFLRRQKRGRPDTWLYRQLQWRITTRYPLLTGWVGGHLLITRSGFWSNRRTIR
 
Nucleotide Sequence: 399 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c508167-507769 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCAGCATATCCGCATGTCCGCGCAGACGGCACAGTGACGTTCCTGCCACATCGGCTCAATCGACATC
CGGTGGTGGTGCGCGGACTGACGGCCGATGAGTTGTGGATCTGTTGTGGCCTGTTCGGCTGCGCCGGGTT
GCTCATCGGCGTACCGCTGTCCTGGTTACTTTCGACCATCGCTCTGGCACCGACTTGTATTGTGCTGGGC
ATCACCTGCGGCGTATTCGTCGGAGGTGGCTTCCTGCGACGGCAGAAACGCGGGCGACCCGACACCTGGC
TGTACCGCCAATTGCAATGGCGTATCACAACCCGCTATCCACTGCTCACAGGCTGGGTCGGCGGGCACCT
GCTGATTACGCGATCGGGCTTCTGGTCGAACCGGAGGACGATACGATGA
 Primer design