SecReT4
Protein ID: 251788086
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0441
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]508180..508539 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDC6CI82
KEGG IDdze:Dd1591_0441
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 4e-35, Aligned region: 32..118
Protein Sequence: 119 a.a.     [Download]
>gi|251788086|ref|YP_003002807.1| hypothetical protein Dd1591_0441 [Dickeya zeae Ech1591]
MKHYRYPTRLVQRAALVLGLTTLPALSFAQGLPQLENPSRGTGGGIMETIRNYGYDIVLLVALLVVASMF
IGVCYHAYGTYAEIHNGKKTWGQFGLTVAVGAVLLVIGIWLLTEATGIL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c508539-508180 Dickeya zeae Ech1591 chromosome, complete genome
ATGAAACACTACCGCTATCCCACCCGTCTCGTTCAGCGCGCTGCGCTGGTCTTGGGCCTTACCACCTTAC
CTGCATTGTCGTTTGCACAGGGATTGCCGCAACTGGAAAACCCATCGCGTGGCACAGGTGGCGGCATCAT
GGAAACCATCCGCAATTACGGCTACGACATCGTGCTACTGGTTGCACTACTGGTGGTCGCCAGCATGTTC
ATTGGAGTGTGCTATCACGCGTACGGCACCTACGCCGAGATCCACAACGGCAAGAAAACCTGGGGCCAGT
TTGGCTTGACGGTCGCGGTTGGGGCGGTGCTGTTGGTGATCGGCATCTGGCTGCTCACCGAAGCTACTGG
CATTTTGTAA
 Primer design