SecReT4
Protein ID: 251788088
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0443
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]508788..509165 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDC6CI84
KEGG IDdze:Dd1591_0443
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 3.1e-28, Aligned region: 31..108
Protein Sequence: 125 a.a.     [Download]
>gi|251788088|ref|YP_003002809.1| hypothetical protein Dd1591_0443 [Dickeya zeae Ech1591]
MGISIYAGAVRYSAVLLIATFWMGTSLPVSADTPAQRQELAAALRQLDALQRVVAQSAATTPLAPNERYY
FDYPRLLDDLAHVRSGIQFYLSPSRAQPRDTTELNSDYRLESAPKHRSTSQEDQP
 
Nucleotide Sequence: 378 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c509165-508788 Dickeya zeae Ech1591 chromosome, complete genome
ATGGGGATTTCTATCTATGCTGGTGCTGTACGCTACAGTGCTGTTCTACTTATCGCCACCTTCTGGATGG
GGACTTCACTACCAGTTTCCGCAGATACACCAGCACAGCGCCAGGAGCTGGCCGCCGCGCTACGTCAGTT
GGACGCCCTGCAACGCGTTGTCGCGCAGAGCGCCGCAACTACGCCGCTCGCGCCAAACGAACGCTATTAC
TTCGACTACCCCCGGCTACTCGATGACTTAGCACACGTGCGATCTGGTATCCAGTTCTATCTTTCGCCGT
CTCGCGCCCAACCACGCGACACCACCGAACTGAACAGTGACTACCGCCTGGAATCGGCTCCCAAGCACCG
CAGCACCTCGCAGGAGGACCAACCATGA
 Primer design