SecReT4
Protein ID: 251788092
T4SS name [ID]Tfc [689]
Gene symbol-
Locus tagDd1591_0447
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T4SS(s) in this replicon]
Location [Strand]512527..513276 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDC6CI88
KEGG IDdze:Dd1591_0447
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 8.9e-69, Aligned region: 47..246
Protein Sequence: 249 a.a.     [Download]
>gi|251788092|ref|YP_003002813.1| hypothetical protein Dd1591_0447 [Dickeya zeae Ech1591]
MSDPAAAAQHQQTRRQSLLASVITLPFRLLGVLIGSLLISIIVECAGMNLFWKDQGWRHSQAMLQYELGH
LSNNFTRSAIVQEPGRTAHQIVDTGYEWMFVKTGLFERIKQIAERARAPSQTPKHDFRYSVSQVYIWLEN
YLIAAAFTTLTFMVRLLVLVLTLPLILMAVFVGLVDGLVRRDVRRFGAGRESGFIYHRAKAALLPLAMLP
WVTYLALPISVHPLLILLPGAALLGFAVNLTVGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c513276-512527 Dickeya zeae Ech1591 chromosome, complete genome
ATGAGCGATCCGGCTGCTGCTGCACAACACCAACAGACACGCCGACAAAGCCTGCTGGCCAGTGTCATCA
CCTTGCCGTTCAGGTTGCTTGGCGTGCTGATCGGCTCGTTGCTGATTTCAATCATCGTGGAATGCGCAGG
CATGAATCTCTTCTGGAAAGACCAAGGCTGGCGACACTCGCAGGCAATGCTGCAATACGAATTGGGACAC
CTGTCGAATAATTTTACCCGCAGCGCCATTGTGCAGGAGCCGGGGCGAACTGCGCACCAGATCGTTGATA
CCGGTTATGAATGGATGTTCGTCAAGACCGGACTGTTTGAGCGCATAAAGCAGATCGCCGAGCGTGCCCG
TGCTCCCAGCCAGACACCCAAACACGACTTCCGCTACTCCGTAAGCCAAGTCTATATATGGTTGGAAAAC
TATCTGATCGCCGCAGCCTTCACCACGCTGACGTTCATGGTACGCTTGCTGGTACTGGTGCTGACATTGC
CGCTCATTCTCATGGCCGTGTTCGTCGGGCTAGTGGATGGTCTGGTTCGGCGCGATGTGCGCAGGTTTGG
CGCGGGTCGGGAATCGGGCTTCATTTACCACCGGGCAAAGGCCGCGTTACTGCCGCTGGCCATGCTGCCC
TGGGTAACCTACCTGGCGCTGCCGATATCGGTACATCCGCTGCTGATCCTGCTGCCTGGCGCAGCGCTGC
TGGGATTTGCAGTAAATCTCACTGTGGGTAGTTTTAAGAAATATTTGTGA
 Primer design